Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | NW963_RS11770 | Genome accession | NZ_CP102972 |
| Coordinates | 2348403..2348873 (-) | Length | 156 a.a. |
| NCBI ID | WP_258411814.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 05-RR-90 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2318058..2369442 | 2348403..2348873 | within | 0 |
Gene organization within MGE regions
Location: 2318058..2369442
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW963_RS11550 (NW963_11545) | - | 2318058..2318384 (-) | 327 | WP_000599589.1 | PH domain-containing protein | - |
| NW963_RS11555 (NW963_11550) | - | 2318448..2318609 (-) | 162 | Protein_2230 | transcriptional regulator | - |
| NW963_RS11560 (NW963_11555) | - | 2318929..2319111 (-) | 183 | Protein_2231 | DNA-binding protein | - |
| NW963_RS11565 (NW963_11560) | - | 2319497..2320951 (-) | 1455 | WP_258412276.1 | N-acetylmuramoyl-L-alanine amidase | - |
| NW963_RS11570 (NW963_11565) | - | 2320962..2321264 (-) | 303 | WP_251359527.1 | phage holin | - |
| NW963_RS11575 (NW963_11570) | - | 2321391..2321765 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| NW963_RS11580 (NW963_11575) | - | 2321821..2322108 (-) | 288 | WP_031763773.1 | hypothetical protein | - |
| NW963_RS11585 (NW963_11580) | - | 2322154..2322306 (-) | 153 | WP_196429569.1 | hypothetical protein | - |
| NW963_RS11590 (NW963_11585) | - | 2322299..2326906 (-) | 4608 | WP_258412277.1 | phage tail spike protein | - |
| NW963_RS11595 (NW963_11590) | - | 2326922..2328406 (-) | 1485 | WP_258412278.1 | phage tail family protein | - |
| NW963_RS11600 (NW963_11595) | - | 2328406..2332929 (-) | 4524 | WP_258412279.1 | phage tail tape measure protein | - |
| NW963_RS11605 (NW963_11600) | - | 2332986..2333120 (-) | 135 | WP_000364140.1 | hypothetical protein | - |
| NW963_RS11610 (NW963_11605) | - | 2333174..2333524 (-) | 351 | WP_031906184.1 | hypothetical protein | - |
| NW963_RS11615 (NW963_11610) | - | 2333574..2333813 (-) | 240 | WP_150530609.1 | Ig-like domain-containing protein | - |
| NW963_RS11620 (NW963_11615) | - | 2333840..2334484 (-) | 645 | WP_258412280.1 | major tail protein | - |
| NW963_RS11625 (NW963_11620) | - | 2334485..2334892 (-) | 408 | WP_258412281.1 | hypothetical protein | - |
| NW963_RS11630 (NW963_11625) | - | 2334889..2335293 (-) | 405 | WP_258412282.1 | HK97 gp10 family phage protein | - |
| NW963_RS11635 (NW963_11630) | - | 2335290..2335652 (-) | 363 | WP_031872356.1 | head-tail adaptor protein | - |
| NW963_RS11640 (NW963_11635) | - | 2335636..2335917 (-) | 282 | WP_258411279.1 | phage head-tail adapter protein | - |
| NW963_RS11645 (NW963_11640) | - | 2335926..2336204 (-) | 279 | WP_258412283.1 | hypothetical protein | - |
| NW963_RS11650 (NW963_11645) | - | 2336223..2337362 (-) | 1140 | WP_258412284.1 | phage major capsid protein | - |
| NW963_RS11655 (NW963_11650) | - | 2337386..2338108 (-) | 723 | WP_258412285.1 | head maturation protease, ClpP-related | - |
| NW963_RS11660 (NW963_11655) | - | 2338105..2339253 (-) | 1149 | WP_070004535.1 | phage portal protein | - |
| NW963_RS11665 (NW963_11660) | - | 2339268..2340929 (-) | 1662 | WP_258412286.1 | terminase large subunit | - |
| NW963_RS11670 (NW963_11665) | - | 2340926..2341270 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| NW963_RS11675 (NW963_11670) | - | 2341400..2341699 (-) | 300 | WP_000988332.1 | HNH endonuclease | - |
| NW963_RS11680 (NW963_11675) | - | 2341931..2342347 (-) | 417 | WP_000590126.1 | hypothetical protein | - |
| NW963_RS11685 (NW963_11680) | - | 2342375..2342569 (-) | 195 | WP_258412527.1 | DUF1514 family protein | - |
| NW963_RS11690 (NW963_11685) | - | 2342569..2342718 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| NW963_RS11695 (NW963_11690) | - | 2342711..2342911 (-) | 201 | WP_258410179.1 | hypothetical protein | - |
| NW963_RS11700 (NW963_11695) | - | 2342908..2343114 (-) | 207 | WP_258410180.1 | DUF1381 domain-containing protein | - |
| NW963_RS11705 (NW963_11700) | - | 2343259..2343519 (-) | 261 | WP_258410181.1 | hypothetical protein | - |
| NW963_RS11710 (NW963_11705) | - | 2343556..2344086 (-) | 531 | WP_258412287.1 | dUTP pyrophosphatase | - |
| NW963_RS11715 (NW963_11710) | - | 2344079..2344249 (-) | 171 | WP_258412288.1 | hypothetical protein | - |
| NW963_RS11720 (NW963_11715) | - | 2344236..2344490 (-) | 255 | WP_258412290.1 | DUF1024 family protein | - |
| NW963_RS11725 (NW963_11720) | - | 2344483..2344893 (-) | 411 | WP_258412291.1 | acetyltransferase | - |
| NW963_RS11730 (NW963_11725) | - | 2344890..2345399 (-) | 510 | WP_258412292.1 | hypothetical protein | - |
| NW963_RS11735 (NW963_11730) | - | 2345396..2345812 (-) | 417 | WP_258411286.1 | YopX family protein | - |
| NW963_RS11740 (NW963_11735) | - | 2345809..2346210 (-) | 402 | WP_258412293.1 | hypothetical protein | - |
| NW963_RS11745 (NW963_11740) | - | 2346224..2346466 (-) | 243 | WP_258412294.1 | phi PVL orf 51-like protein | - |
| NW963_RS11750 (NW963_11745) | - | 2346470..2346838 (-) | 369 | WP_258412295.1 | SA1788 family PVL leukocidin-associated protein | - |
| NW963_RS11755 (NW963_11750) | - | 2346851..2347255 (-) | 405 | WP_258412296.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NW963_RS11760 (NW963_11755) | - | 2347264..2347482 (-) | 219 | WP_258411812.1 | hypothetical protein | - |
| NW963_RS11765 (NW963_11760) | - | 2347489..2348373 (-) | 885 | WP_258412297.1 | DnaD domain protein | - |
| NW963_RS11770 (NW963_11765) | ssbA | 2348403..2348873 (-) | 471 | WP_258411814.1 | single-stranded DNA-binding protein | Machinery gene |
| NW963_RS11775 (NW963_11770) | - | 2348874..2349491 (-) | 618 | WP_077517322.1 | MBL fold metallo-hydrolase | - |
| NW963_RS11780 (NW963_11775) | - | 2349572..2350493 (-) | 922 | Protein_2275 | recombinase RecT | - |
| NW963_RS11785 (NW963_11780) | - | 2350495..2352438 (-) | 1944 | WP_258412298.1 | AAA family ATPase | - |
| NW963_RS11790 (NW963_11785) | - | 2352447..2352710 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| NW963_RS11795 (NW963_11790) | - | 2352719..2352979 (-) | 261 | WP_258412299.1 | DUF1108 family protein | - |
| NW963_RS11800 (NW963_11795) | - | 2352960..2353286 (-) | 327 | WP_234726024.1 | DUF2482 family protein | - |
| NW963_RS11805 (NW963_11800) | - | 2353381..2353542 (-) | 162 | WP_209025520.1 | DUF1270 family protein | - |
| NW963_RS11810 (NW963_11805) | - | 2353555..2353818 (-) | 264 | WP_115207353.1 | helix-turn-helix domain-containing protein | - |
| NW963_RS11815 (NW963_11810) | - | 2353833..2354588 (-) | 756 | WP_258412300.1 | phage regulatory protein/antirepressor Ant | - |
| NW963_RS11820 (NW963_11815) | - | 2354644..2355024 (+) | 381 | WP_209025522.1 | DUF2513 domain-containing protein | - |
| NW963_RS11825 (NW963_11820) | - | 2355011..2355208 (-) | 198 | WP_209025523.1 | hypothetical protein | - |
| NW963_RS11830 (NW963_11825) | - | 2355249..2355566 (-) | 318 | WP_196429542.1 | hypothetical protein | - |
| NW963_RS11835 (NW963_11830) | - | 2355582..2355791 (-) | 210 | WP_047447803.1 | helix-turn-helix transcriptional regulator | - |
| NW963_RS11840 (NW963_11835) | - | 2355988..2356617 (+) | 630 | WP_258411297.1 | XRE family transcriptional regulator | - |
| NW963_RS11845 (NW963_11840) | - | 2356632..2357522 (+) | 891 | WP_258411298.1 | exonuclease domain-containing protein | - |
| NW963_RS11850 (NW963_11845) | - | 2357660..2358061 (-) | 402 | WP_258412301.1 | hypothetical protein | - |
| NW963_RS11855 (NW963_11850) | - | 2358409..2359614 (+) | 1206 | WP_258412302.1 | site-specific integrase | - |
| NW963_RS11860 (NW963_11855) | - | 2359709..2360308 (-) | 600 | Protein_2291 | transcriptional regulator | - |
| NW963_RS11865 (NW963_11860) | - | 2360335..2362290 (-) | 1956 | WP_258412303.1 | AraC family transcriptional regulator | - |
| NW963_RS11870 (NW963_11865) | - | 2362900..2363709 (+) | 810 | WP_258412304.1 | CHAP domain-containing protein | - |
| NW963_RS11875 (NW963_11870) | - | 2363727..2363969 (-) | 243 | WP_258412305.1 | hypothetical protein | - |
| NW963_RS11880 (NW963_11875) | nhaC | 2364143..2365543 (-) | 1401 | WP_000977733.1 | Na+/H+ antiporter NhaC | - |
| NW963_RS11885 (NW963_11880) | - | 2365638..2366720 (-) | 1083 | WP_000684567.1 | NAD/NADP-dependent octopine/nopaline dehydrogenase family protein | - |
| NW963_RS11890 (NW963_11885) | - | 2366968..2367390 (+) | 423 | WP_000206114.1 | DUF4870 domain-containing protein | - |
| NW963_RS11895 (NW963_11890) | - | 2367627..2368127 (+) | 501 | WP_000737705.1 | CHAP domain-containing protein | - |
| NW963_RS11900 (NW963_11895) | - | 2368489..2369442 (+) | 954 | WP_000417016.1 | 2-hydroxyacid dehydrogenase family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17671.55 Da Isoelectric Point: 5.2672
>NTDB_id=720933 NW963_RS11770 WP_258411814.1 2348403..2348873(-) (ssbA) [Staphylococcus aureus strain 05-RR-90]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYQQQAQQTRGQSQYPYNKPVKDNPFANANGPIEIDDNDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDNQQDLYQQQAQQTRGQSQYPYNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=720933 NW963_RS11770 WP_258411814.1 2348403..2348873(-) (ssbA) [Staphylococcus aureus strain 05-RR-90]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCGGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAAACACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCGGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGATAATCAACAAGATTTATACCAACAACAAGCGCAACAAACACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.802 |
100 |
0.622 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.571 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.844 |
100 |
0.365 |