Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | NJ242_RS04755 | Genome accession | NZ_CP100391 |
| Coordinates | 933928..934068 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain PHP1601 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 928928..939068
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NJ242_RS04730 (NJ242_04730) | - | 929231..929629 (+) | 399 | WP_003152031.1 | YueI family protein | - |
| NJ242_RS04735 (NJ242_04735) | - | 929726..930277 (+) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| NJ242_RS04740 (NJ242_04740) | - | 930295..931761 (+) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| NJ242_RS04745 (NJ242_04745) | - | 931891..933114 (+) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| NJ242_RS04750 (NJ242_04750) | - | 933121..933462 (-) | 342 | WP_032876795.1 | hypothetical protein | - |
| NJ242_RS04755 (NJ242_04755) | degQ | 933928..934068 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| NJ242_RS04760 (NJ242_04760) | - | 934276..935136 (+) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| NJ242_RS04765 (NJ242_04765) | comX | 935105..935278 (+) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| NJ242_RS04770 (NJ242_04770) | comP | 935292..937592 (+) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| NJ242_RS04775 (NJ242_04775) | comA | 937673..938317 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| NJ242_RS04780 (NJ242_04780) | - | 938339..938722 (+) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=704842 NJ242_RS04755 WP_003152043.1 933928..934068(+) (degQ) [Bacillus velezensis strain PHP1601]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=704842 NJ242_RS04755 WP_003152043.1 933928..934068(+) (degQ) [Bacillus velezensis strain PHP1601]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |