Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   BAZ_RS19020 Genome accession   NZ_AP018443
Coordinates   3634062..3634841 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus anthracis strain CZC5     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3599740..3673664 3634062..3634841 within 0


Gene organization within MGE regions


Location: 3599740..3673664
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAZ_RS18865 (BAZ_03821) - 3600084..3601754 (-) 1671 WP_000823085.1 ribonuclease J -
  BAZ_RS18875 (BAZ_03822) dapA 3602520..3603398 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  BAZ_RS18880 (BAZ_03823) dapG 3603410..3604642 (-) 1233 WP_000692470.1 aspartate kinase -
  BAZ_RS18885 (BAZ_03824) asd 3604666..3605712 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  BAZ_RS18890 (BAZ_03825) dpaB 3605863..3606462 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  BAZ_RS18895 (BAZ_03826) dpaA 3606459..3607361 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  BAZ_RS18900 (BAZ_03827) - 3607636..3607887 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  BAZ_RS18905 (BAZ_03828) - 3608014..3609255 (-) 1242 WP_000592993.1 pitrilysin family protein -
  BAZ_RS18910 (BAZ_03829) - 3609342..3610241 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  BAZ_RS18915 (BAZ_03830) pnp 3610393..3612531 (-) 2139 WP_000076750.1 polyribonucleotide nucleotidyltransferase -
  BAZ_RS18920 (BAZ_03831) rpsO 3612692..3612961 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  BAZ_RS18925 (BAZ_03832) ribF 3613062..3614033 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  BAZ_RS18930 (BAZ_03833) truB 3614077..3615000 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  BAZ_RS18935 (BAZ_03834) rbfA 3615087..3615443 (-) 357 WP_000776446.1 30S ribosome-binding factor RbfA -
  BAZ_RS18940 (BAZ_03835) - 3615459..3615740 (-) 282 WP_000582364.1 DUF503 family protein -
  BAZ_RS18945 (BAZ_03836) infB 3615737..3617797 (-) 2061 WP_000036339.1 translation initiation factor IF-2 -
  BAZ_RS18950 (BAZ_03837) - 3617802..3618113 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  BAZ_RS18955 (BAZ_03838) - 3618114..3618386 (-) 273 WP_000071128.1 YlxR family protein -
  BAZ_RS18960 (BAZ_03839) nusA 3618398..3619504 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  BAZ_RS18965 (BAZ_03840) rimP 3619522..3619992 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  BAZ_RS18970 (BAZ_03841) - 3620325..3624626 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  BAZ_RS18975 (BAZ_03842) - 3624751..3626451 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  BAZ_RS18980 (BAZ_03843) rseP 3626561..3627817 (-) 1257 WP_001090228.1 RIP metalloprotease RseP -
  BAZ_RS18985 (BAZ_03844) dxr 3627834..3628976 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  BAZ_RS18990 (BAZ_03845) cdsA 3629000..3629791 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  BAZ_RS18995 (BAZ_03846) uppS 3629809..3630585 (-) 777 WP_000971303.1 isoprenyl transferase -
  BAZ_RS19000 (BAZ_03847) frr 3630671..3631228 (-) 558 WP_000531503.1 ribosome recycling factor -
  BAZ_RS19005 (BAZ_03848) pyrH 3631231..3631953 (-) 723 WP_000042663.1 UMP kinase -
  BAZ_RS19010 (BAZ_03849) tsf 3632020..3632907 (-) 888 WP_001018581.1 translation elongation factor Ts -
  BAZ_RS19015 (BAZ_03850) rpsB 3633011..3633712 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  BAZ_RS19020 (BAZ_03851) codY 3634062..3634841 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  BAZ_RS19025 (BAZ_03852) hslU 3634919..3636310 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  BAZ_RS19030 (BAZ_03853) hslV 3636333..3636875 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  BAZ_RS19035 (BAZ_03854) xerC 3636918..3637817 (-) 900 WP_001101226.1 tyrosine recombinase XerC -
  BAZ_RS19040 (BAZ_03855) trmFO 3637883..3639187 (-) 1305 WP_003161605.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  BAZ_RS19045 (BAZ_03856) topA 3639238..3641316 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  BAZ_RS19050 (BAZ_03857) dprA 3641461..3642329 (-) 869 Protein_3695 DNA-processing protein DprA -
  BAZ_RS19055 (BAZ_03858) sucD 3642417..3643319 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  BAZ_RS19060 (BAZ_03859) sucC 3643340..3644500 (-) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  BAZ_RS19065 (BAZ_03860) rnhB 3644694..3645467 (-) 774 WP_001174712.1 ribonuclease HII -
  BAZ_RS19070 (BAZ_03861) ylqF 3645519..3646409 (-) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  BAZ_RS19075 (BAZ_03862) lepB 3646430..3646981 (-) 552 WP_000711857.1 signal peptidase I -
  BAZ_RS19080 (BAZ_03863) rplS 3647083..3647427 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  BAZ_RS19085 (BAZ_03864) trmD 3647574..3648308 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  BAZ_RS19090 (BAZ_03865) rimM 3648308..3648823 (-) 516 WP_000170269.1 ribosome maturation factor RimM -
  BAZ_RS19095 (BAZ_03866) - 3648944..3649171 (-) 228 WP_000737398.1 KH domain-containing protein -
  BAZ_RS19100 (BAZ_03867) rpsP 3649186..3649458 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  BAZ_RS19105 (BAZ_03868) ffh 3649559..3650908 (-) 1350 WP_000863456.1 signal recognition particle protein -
  BAZ_RS19110 (BAZ_03869) - 3650921..3651253 (-) 333 WP_000891062.1 putative DNA-binding protein -
  BAZ_RS19115 (BAZ_03870) ftsY 3651387..3652376 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  BAZ_RS19120 (BAZ_03871) smc 3652392..3655961 (-) 3570 WP_000478985.1 chromosome segregation protein SMC -
  BAZ_RS19125 (BAZ_03872) rncS 3656108..3656845 (-) 738 WP_001146873.1 ribonuclease III -
  BAZ_RS19130 (BAZ_03873) acpP 3656904..3657137 (-) 234 WP_000786062.1 acyl carrier protein -
  BAZ_RS19135 (BAZ_03874) fabG 3657207..3657947 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  BAZ_RS19140 (BAZ_03875) fabD 3657947..3658891 (-) 945 WP_033646952.1 ACP S-malonyltransferase -
  BAZ_RS19145 (BAZ_03876) plsX 3658906..3659898 (-) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  BAZ_RS19150 (BAZ_03877) fapR 3659895..3660488 (-) 594 WP_000747352.1 transcription factor FapR -
  BAZ_RS19155 (BAZ_03878) recG 3660577..3662625 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  BAZ_RS19160 (BAZ_03879) - 3662915..3664591 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  BAZ_RS19165 (BAZ_03880) - 3664614..3664976 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  BAZ_RS19170 (BAZ_03881) rpmB 3665355..3665543 (+) 189 WP_000124778.1 50S ribosomal protein L28 -
  BAZ_RS19175 spoVM 3665616..3665696 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  BAZ_RS19180 (BAZ_03882) - 3665763..3666443 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  BAZ_RS19185 (BAZ_03883) rpe 3666543..3667187 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  BAZ_RS19190 (BAZ_03884) rsgA 3667190..3668071 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  BAZ_RS19195 (BAZ_03885) prkC 3668340..3670313 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  BAZ_RS19200 (BAZ_03886) - 3670322..3671074 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  BAZ_RS19205 (BAZ_03887) rlmN 3671079..3672167 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  BAZ_RS19210 (BAZ_03888) rsmB 3672172..3673506 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=69669 BAZ_RS19020 WP_000421288.1 3634062..3634841(-) (codY) [Bacillus anthracis strain CZC5]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=69669 BAZ_RS19020 WP_000421288.1 3634062..3634841(-) (codY) [Bacillus anthracis strain CZC5]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459

Multiple sequence alignment