Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   M8969_RS15335 Genome accession   NZ_CP097593
Coordinates   3100101..3100415 (+) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain UA0229     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3095101..3105415
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8969_RS15310 - 3096136..3097086 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  M8969_RS15315 comGA 3097283..3098353 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  M8969_RS15320 comGB 3098340..3099377 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  M8969_RS15325 comGC 3099382..3099690 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  M8969_RS15330 comGD 3099680..3100117 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8969_RS15335 comGE 3100101..3100415 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  M8969_RS15340 comGF 3100324..3100824 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  M8969_RS15345 comGG 3100825..3101202 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8969_RS15350 - 3101259..3101438 (+) 180 WP_022552966.1 YqzE family protein -
  M8969_RS15355 - 3101479..3101808 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  M8969_RS15360 tapA 3102067..3102738 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  M8969_RS15365 - 3102710..3103294 (+) 585 WP_032874025.1 signal peptidase I -
  M8969_RS15370 - 3103359..3104144 (+) 786 WP_032874027.1 TasA family protein -
  M8969_RS15375 sinR 3104192..3104527 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8969_RS15380 sinI 3104561..3104734 (-) 174 WP_032874029.1 anti-repressor SinI family protein Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=690887 M8969_RS15335 WP_032874016.1 3100101..3100415(+) (comGE) [Bacillus velezensis strain UA0229]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=690887 M8969_RS15335 WP_032874016.1 3100101..3100415(+) (comGE) [Bacillus velezensis strain UA0229]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481