Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   MUU70_RS01975 Genome accession   NZ_CP095093
Coordinates   386959..387078 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain D103     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 381959..392078
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MUU70_RS01960 (MUU70_01965) - 383571..384254 (+) 684 WP_070081359.1 response regulator transcription factor -
  MUU70_RS01965 (MUU70_01970) - 384241..385674 (+) 1434 WP_161941456.1 HAMP domain-containing sensor histidine kinase -
  MUU70_RS01970 (MUU70_01975) rapC 385827..386975 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  MUU70_RS01975 (MUU70_01980) phrC 386959..387078 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  MUU70_RS01980 (MUU70_01985) - 387228..387323 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  MUU70_RS01985 (MUU70_01990) - 387418..388782 (-) 1365 WP_176283117.1 aspartate kinase -
  MUU70_RS01990 (MUU70_01995) ceuB 389197..390150 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  MUU70_RS01995 (MUU70_02000) - 390140..391087 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  MUU70_RS02000 (MUU70_02005) - 391081..391839 (+) 759 WP_071392129.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=675285 MUU70_RS01975 WP_003156334.1 386959..387078(+) (phrC) [Bacillus velezensis strain D103]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=675285 MUU70_RS01975 WP_003156334.1 386959..387078(+) (phrC) [Bacillus velezensis strain D103]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718