Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   BASH2_RS10395 Genome accession   NZ_AP014833
Coordinates   1825366..1826145 (+) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus anthracis strain Shikan-NIID     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1786544..1860467 1825366..1826145 within 0


Gene organization within MGE regions


Location: 1786544..1860467
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BASH2_RS10205 (BASH2_01934) rsmB 1786702..1788036 (+) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  BASH2_RS10210 (BASH2_01935) rlmN 1788041..1789129 (+) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  BASH2_RS10215 (BASH2_01936) - 1789134..1789886 (+) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  BASH2_RS10220 (BASH2_01937) prkC 1789895..1791868 (+) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  BASH2_RS10225 (BASH2_01938) rsgA 1792137..1793018 (+) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  BASH2_RS10230 (BASH2_01939) rpe 1793021..1793665 (+) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  BASH2_RS10235 (BASH2_01940) - 1793765..1794445 (+) 681 WP_025388434.1 thiamine diphosphokinase -
  BASH2_RS10240 spoVM 1794512..1794592 (+) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  BASH2_RS10245 (BASH2_01941) rpmB 1794665..1794853 (-) 189 WP_000124778.1 50S ribosomal protein L28 -
  BASH2_RS10250 (BASH2_01942) - 1795232..1795594 (+) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  BASH2_RS10255 (BASH2_01943) - 1795617..1797293 (+) 1677 WP_000027136.1 DAK2 domain-containing protein -
  BASH2_RS10260 (BASH2_01944) recG 1797583..1799631 (+) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  BASH2_RS10265 (BASH2_01945) fapR 1799720..1800313 (+) 594 WP_000747352.1 transcription factor FapR -
  BASH2_RS10270 (BASH2_01946) plsX 1800310..1801302 (+) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  BASH2_RS10275 (BASH2_01947) fabD 1801317..1802261 (+) 945 WP_000516958.1 ACP S-malonyltransferase -
  BASH2_RS10280 (BASH2_01948) fabG 1802261..1803001 (+) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  BASH2_RS10285 (BASH2_01949) acpP 1803071..1803304 (+) 234 WP_000786062.1 acyl carrier protein -
  BASH2_RS10290 (BASH2_01950) rncS 1803363..1804100 (+) 738 WP_001146873.1 ribonuclease III -
  BASH2_RS10295 (BASH2_01951) smc 1804247..1807816 (+) 3570 WP_000478985.1 chromosome segregation protein SMC -
  BASH2_RS10300 (BASH2_01952) ftsY 1807832..1808821 (+) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  BASH2_RS10305 (BASH2_01953) - 1808954..1809286 (+) 333 WP_000891062.1 putative DNA-binding protein -
  BASH2_RS10310 (BASH2_01954) ffh 1809299..1810648 (+) 1350 WP_000863456.1 signal recognition particle protein -
  BASH2_RS10315 (BASH2_01955) rpsP 1810749..1811021 (+) 273 WP_000268750.1 30S ribosomal protein S16 -
  BASH2_RS10320 (BASH2_01956) - 1811036..1811263 (+) 228 WP_000737398.1 KH domain-containing protein -
  BASH2_RS10325 (BASH2_01957) rimM 1811384..1811899 (+) 516 WP_000170269.1 ribosome maturation factor RimM -
  BASH2_RS10330 (BASH2_01958) trmD 1811899..1812633 (+) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  BASH2_RS10335 (BASH2_01959) rplS 1812780..1813124 (+) 345 WP_001186516.1 50S ribosomal protein L19 -
  BASH2_RS10340 (BASH2_01960) lepB 1813226..1813777 (+) 552 WP_000711857.1 signal peptidase I -
  BASH2_RS10345 (BASH2_01961) ylqF 1813798..1814688 (+) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  BASH2_RS10350 (BASH2_01962) rnhB 1814740..1815513 (+) 774 WP_001174712.1 ribonuclease HII -
  BASH2_RS10355 (BASH2_01963) sucC 1815707..1816867 (+) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  BASH2_RS10360 (BASH2_01964) sucD 1816888..1817790 (+) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  BASH2_RS10365 (BASH2_01965) dprA 1818112..1818746 (+) 635 Protein_1909 DNA-processing protein DprA -
  BASH2_RS10370 (BASH2_01966) topA 1818891..1820969 (+) 2079 WP_001286969.1 type I DNA topoisomerase -
  BASH2_RS10375 (BASH2_01967) trmFO 1821020..1822324 (+) 1305 WP_003161605.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  BASH2_RS10380 (BASH2_01968) xerC 1822390..1823289 (+) 900 WP_001101226.1 tyrosine recombinase XerC -
  BASH2_RS10385 (BASH2_01969) hslV 1823332..1823874 (+) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  BASH2_RS10390 (BASH2_01970) hslU 1823897..1825288 (+) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  BASH2_RS10395 (BASH2_01971) codY 1825366..1826145 (+) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  BASH2_RS10400 (BASH2_01972) rpsB 1826495..1827196 (+) 702 WP_000111483.1 30S ribosomal protein S2 -
  BASH2_RS10405 (BASH2_01973) tsf 1827300..1828187 (+) 888 WP_001018581.1 translation elongation factor Ts -
  BASH2_RS10410 (BASH2_01974) pyrH 1828254..1828976 (+) 723 WP_000042663.1 UMP kinase -
  BASH2_RS10415 (BASH2_01975) frr 1828979..1829536 (+) 558 WP_000531498.1 ribosome recycling factor -
  BASH2_RS10420 (BASH2_01976) uppS 1829622..1830398 (+) 777 WP_000971303.1 isoprenyl transferase -
  BASH2_RS10425 (BASH2_01977) cdsA 1830416..1831207 (+) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  BASH2_RS10430 (BASH2_01978) dxr 1831231..1832373 (+) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  BASH2_RS10435 (BASH2_01979) rseP 1832390..1833646 (+) 1257 WP_001090228.1 RIP metalloprotease RseP -
  BASH2_RS10440 (BASH2_01980) - 1833756..1835456 (+) 1701 WP_000814312.1 proline--tRNA ligase -
  BASH2_RS10450 (BASH2_01982) - 1835581..1839882 (+) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  BASH2_RS10455 (BASH2_01983) rimP 1840215..1840685 (+) 471 WP_000359097.1 ribosome maturation factor RimP -
  BASH2_RS10460 (BASH2_01984) nusA 1840703..1841809 (+) 1107 WP_000102609.1 transcription termination factor NusA -
  BASH2_RS10465 (BASH2_01985) rnpM 1841821..1842093 (+) 273 WP_000071128.1 RNase P modulator RnpM -
  BASH2_RS10470 (BASH2_01986) - 1842094..1842405 (+) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  BASH2_RS10475 (BASH2_01987) infB 1842410..1844470 (+) 2061 WP_000036339.1 translation initiation factor IF-2 -
  BASH2_RS10480 (BASH2_01988) - 1844467..1844748 (+) 282 WP_000582364.1 DUF503 domain-containing protein -
  BASH2_RS10485 (BASH2_01989) rbfA 1844764..1845120 (+) 357 WP_000776446.1 30S ribosome-binding factor RbfA -
  BASH2_RS10490 (BASH2_01990) truB 1845207..1846130 (+) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  BASH2_RS10495 (BASH2_01991) ribF 1846174..1847145 (+) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  BASH2_RS10500 rpsO 1847246..1847515 (+) 270 WP_001229392.1 30S ribosomal protein S15 -
  BASH2_RS10505 (BASH2_01992) pnp 1847676..1849814 (+) 2139 WP_000076733.1 polyribonucleotide nucleotidyltransferase -
  BASH2_RS10510 (BASH2_01993) - 1849966..1850865 (+) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  BASH2_RS10515 (BASH2_01994) - 1850952..1852193 (+) 1242 WP_000592993.1 M16 family metallopeptidase -
  BASH2_RS10520 (BASH2_01995) - 1852320..1852571 (+) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  BASH2_RS10530 (BASH2_01996) dpaA 1852846..1853748 (+) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  BASH2_RS10535 (BASH2_01997) dpaB 1853745..1854344 (+) 600 WP_001049484.1 dipicolinate synthase subunit B -
  BASH2_RS10540 (BASH2_01998) asd 1854495..1855541 (+) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  BASH2_RS10545 (BASH2_01999) dapG 1855565..1856797 (+) 1233 WP_000692470.1 aspartate kinase -
  BASH2_RS10550 (BASH2_02000) dapA 1856809..1857687 (+) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  BASH2_RS10560 (BASH2_02001) - 1858453..1860123 (+) 1671 WP_000823085.1 ribonuclease J -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=66982 BASH2_RS10395 WP_000421288.1 1825366..1826145(+) (codY) [Bacillus anthracis strain Shikan-NIID]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=66982 BASH2_RS10395 WP_000421288.1 1825366..1826145(+) (codY) [Bacillus anthracis strain Shikan-NIID]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459


Multiple sequence alignment