Detailed information
Bioinformatically predicted
Overview
| Name | comB3 | Type | Machinery gene |
| Locus tag | MPG49_RS00070 | Genome accession | NZ_CP094173 |
| Coordinates | 17839..18102 (+) | Length | 87 a.a. |
| NCBI ID | WP_001177712.1 | Uniprot ID | A0AB33Z5Y9 |
| Organism | Helicobacter pylori strain Hpfe0001 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 5195..65830 | 17839..18102 | within | 0 |
Gene organization within MGE regions
Location: 5195..65830
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MPG49_RS00040 (MPG49_00040) | - | 6937..8403 (+) | 1467 | WP_342376760.1 | site-specific DNA-methyltransferase | - |
| MPG49_RS07990 | - | 8400..8978 (+) | 579 | WP_342376762.1 | site-specific DNA-methyltransferase | - |
| MPG49_RS00045 (MPG49_00045) | - | 8981..11893 (+) | 2913 | WP_245052315.1 | type III restriction-modification system endonuclease | - |
| MPG49_RS00050 (MPG49_00050) | - | 11999..15715 (+) | 3717 | WP_245052317.1 | Eco57I restriction-modification methylase domain-containing protein | - |
| MPG49_RS00055 (MPG49_00055) | - | 16176..16964 (+) | 789 | WP_245052282.1 | integrase | - |
| MPG49_RS00060 (MPG49_00060) | - | 17068..17547 (+) | 480 | WP_245052284.1 | hypothetical protein | - |
| MPG49_RS00065 (MPG49_00065) | comB2 | 17544..17828 (+) | 285 | WP_000736478.1 | TrbC/VirB2 family protein | Machinery gene |
| MPG49_RS00070 (MPG49_00070) | comB3 | 17839..18102 (+) | 264 | WP_001177712.1 | hypothetical protein | Machinery gene |
| MPG49_RS00075 (MPG49_00075) | - | 18113..18349 (+) | 237 | WP_180386948.1 | hypothetical protein | - |
| MPG49_RS00080 (MPG49_00080) | - | 18349..20925 (+) | 2577 | WP_245052286.1 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| MPG49_RS00085 (MPG49_00085) | - | 20922..21062 (+) | 141 | WP_015643441.1 | hypothetical protein | - |
| MPG49_RS00090 (MPG49_00090) | - | 21055..22194 (+) | 1140 | WP_245052287.1 | VirB8/TrbF family protein | - |
| MPG49_RS00095 (MPG49_00095) | - | 22191..23855 (+) | 1665 | WP_245052289.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| MPG49_RS00100 (MPG49_00100) | comB10 | 23852..25054 (+) | 1203 | WP_245052291.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| MPG49_RS00105 (MPG49_00105) | - | 25038..27299 (+) | 2262 | WP_245052293.1 | collagen-like protein | - |
| MPG49_RS00110 (MPG49_00110) | - | 27312..28289 (+) | 978 | WP_245052295.1 | hypothetical protein | - |
| MPG49_RS00115 (MPG49_00115) | - | 28307..28579 (+) | 273 | WP_001917649.1 | hypothetical protein | - |
| MPG49_RS00120 (MPG49_00120) | - | 28584..29528 (+) | 945 | WP_033582549.1 | CpaF/VirB11 family protein | - |
| MPG49_RS00125 (MPG49_00125) | - | 29525..30043 (+) | 519 | WP_120869111.1 | replication regulatory RepB family protein | - |
| MPG49_RS00130 (MPG49_00130) | - | 30040..32304 (+) | 2265 | WP_245052320.1 | type IV secretory system conjugative DNA transfer family protein | - |
| MPG49_RS00135 (MPG49_00135) | - | 32325..34385 (+) | 2061 | WP_245052322.1 | type IA DNA topoisomerase | - |
| MPG49_RS00140 (MPG49_00140) | - | 34440..34910 (+) | 471 | WP_024116506.1 | hypothetical protein | - |
| MPG49_RS00145 (MPG49_00145) | - | 34907..35682 (+) | 776 | Protein_28 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| MPG49_RS00150 (MPG49_00150) | - | 35805..36377 (-) | 573 | WP_245052324.1 | hypothetical protein | - |
| MPG49_RS00155 (MPG49_00155) | - | 36355..36733 (-) | 379 | Protein_30 | hypothetical protein | - |
| MPG49_RS00160 (MPG49_00160) | - | 36795..37445 (-) | 651 | WP_140476845.1 | ParA family protein | - |
| MPG49_RS00165 (MPG49_00165) | - | 38082..38246 (+) | 165 | WP_000189756.1 | hypothetical protein | - |
| MPG49_RS00170 (MPG49_00170) | - | 38247..39314 (+) | 1068 | WP_245052326.1 | ArdC family protein | - |
| MPG49_RS00175 (MPG49_00175) | - | 39314..41080 (+) | 1767 | WP_245052328.1 | hypothetical protein | - |
| MPG49_RS00180 (MPG49_00180) | - | 41090..42523 (+) | 1434 | WP_245052330.1 | toprim domain-containing protein | - |
| MPG49_RS00185 (MPG49_00185) | - | 42520..43770 (+) | 1251 | WP_245052332.1 | P-type conjugative transfer protein TrbL | - |
| MPG49_RS00190 (MPG49_00190) | - | 43767..45023 (+) | 1257 | WP_245052334.1 | hypothetical protein | - |
| MPG49_RS07995 | - | 45045..45774 (-) | 730 | Protein_38 | hypothetical protein | - |
| MPG49_RS00205 (MPG49_00205) | - | 45994..46674 (+) | 681 | WP_245052340.1 | CAAX protease | - |
| MPG49_RS00210 (MPG49_00210) | - | 46806..47057 (+) | 252 | WP_000006537.1 | hypothetical protein | - |
| MPG49_RS00215 (MPG49_00215) | - | 47029..47832 (+) | 804 | WP_000009099.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| MPG49_RS00220 (MPG49_00220) | - | 48150..49217 (-) | 1068 | WP_245052342.1 | tyrosine-type recombinase/integrase | - |
| MPG49_RS00225 (MPG49_00225) | - | 50193..52205 (-) | 2013 | WP_245052344.1 | relaxase/mobilization nuclease domain-containing protein | - |
| MPG49_RS00230 (MPG49_00230) | nusA | 53489..54676 (-) | 1188 | WP_245052346.1 | transcription termination factor NusA | - |
| MPG49_RS00235 (MPG49_00235) | - | 54765..55925 (-) | 1161 | WP_245052348.1 | aminotransferase class V-fold PLP-dependent enzyme | - |
| MPG49_RS00240 (MPG49_00240) | - | 56157..58796 (-) | 2640 | WP_245052350.1 | TonB-dependent receptor | - |
| MPG49_RS00245 (MPG49_00245) | - | 58949..59275 (-) | 327 | WP_245052352.1 | Plug domain-containing protein | - |
| MPG49_RS00250 (MPG49_00250) | - | 59259..59612 (-) | 354 | WP_180520601.1 | dihydroneopterin aldolase | - |
| MPG49_RS00255 (MPG49_00255) | plsY | 59609..60271 (-) | 663 | WP_245053156.1 | glycerol-3-phosphate 1-O-acyltransferase PlsY | - |
| MPG49_RS00260 (MPG49_00260) | ccoG | 60377..61753 (+) | 1377 | WP_245052354.1 | cytochrome c oxidase accessory protein CcoG | - |
| MPG49_RS00265 (MPG49_00265) | - | 61763..62962 (-) | 1200 | WP_245052356.1 | saccharopine dehydrogenase family protein | - |
| MPG49_RS00270 (MPG49_00270) | gltS | 63047..64273 (+) | 1227 | WP_096424374.1 | sodium/glutamate symporter | - |
| MPG49_RS00275 (MPG49_00275) | - | 64270..65304 (+) | 1035 | WP_245052358.1 | bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase | - |
Sequence
Protein
Download Length: 87 a.a. Molecular weight: 10002.89 Da Isoelectric Point: 5.7206
>NTDB_id=667983 MPG49_RS00070 WP_001177712.1 17839..18102(+) (comB3) [Helicobacter pylori strain Hpfe0001]
MQLVGISVSNLKEISSKEKFLWLNAKSFLIAGFIPFVMIPWLDFLNSLMLYVCFLLVFSIAEFFDEDISDILIAHSKIKT
KTNSFYA
MQLVGISVSNLKEISSKEKFLWLNAKSFLIAGFIPFVMIPWLDFLNSLMLYVCFLLVFSIAEFFDEDISDILIAHSKIKT
KTNSFYA
Nucleotide
Download Length: 264 bp
>NTDB_id=667983 MPG49_RS00070 WP_001177712.1 17839..18102(+) (comB3) [Helicobacter pylori strain Hpfe0001]
ATGCAATTAGTCGGCATTTCAGTTTCTAATCTCAAAGAAATCAGTTCTAAAGAAAAGTTTCTTTGGCTCAATGCTAAGAG
CTTTTTAATCGCAGGATTTATTCCTTTTGTAATGATACCTTGGCTAGATTTTTTAAATTCTTTAATGCTGTATGTGTGCT
TTTTATTGGTTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGCGACATTTTAATCGCCCATTCTAAGATTAAAACC
AAAACTAATTCATTTTATGCTTAA
ATGCAATTAGTCGGCATTTCAGTTTCTAATCTCAAAGAAATCAGTTCTAAAGAAAAGTTTCTTTGGCTCAATGCTAAGAG
CTTTTTAATCGCAGGATTTATTCCTTTTGTAATGATACCTTGGCTAGATTTTTTAAATTCTTTAATGCTGTATGTGTGCT
TTTTATTGGTTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGCGACATTTTAATCGCCCATTCTAAGATTAAAACC
AAAACTAATTCATTTTATGCTTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB3 | Helicobacter pylori 26695 |
59.77 |
100 |
0.598 |