Detailed information
Bioinformatically predicted
Overview
| Name | comB2 | Type | Machinery gene |
| Locus tag | MPF84_RS02450 | Genome accession | NZ_CP094149 |
| Coordinates | 503161..503445 (+) | Length | 94 a.a. |
| NCBI ID | WP_000736478.1 | Uniprot ID | - |
| Organism | Helicobacter pylori strain Hpfe023 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 489695..543171 | 503161..503445 | within | 0 |
Gene organization within MGE regions
Location: 489695..543171
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MPF84_RS02405 (MPF84_02405) | - | 490892..492187 (+) | 1296 | WP_245086287.1 | TolC family protein | - |
| MPF84_RS02410 (MPF84_02410) | - | 492184..493263 (+) | 1080 | WP_180620666.1 | efflux RND transporter periplasmic adaptor subunit | - |
| MPF84_RS02415 (MPF84_02415) | - | 493263..496322 (+) | 3060 | WP_245086290.1 | efflux RND transporter permease subunit | - |
| MPF84_RS02420 (MPF84_02420) | - | 496333..496614 (+) | 282 | WP_000880314.1 | DUF3240 family protein | - |
| MPF84_RS02425 (MPF84_02425) | - | 497154..498799 (+) | 1646 | Protein_470 | dynamin family protein | - |
| MPF84_RS02430 (MPF84_02430) | - | 498801..501102 (+) | 2302 | Protein_471 | dynamin family protein | - |
| MPF84_RS02435 (MPF84_02435) | - | 501102..501815 (+) | 714 | WP_245086293.1 | dynamin family protein | - |
| MPF84_RS02440 (MPF84_02440) | - | 501793..502581 (+) | 789 | WP_245086296.1 | integrase | - |
| MPF84_RS02445 (MPF84_02445) | - | 502685..503164 (+) | 480 | WP_245086299.1 | hypothetical protein | - |
| MPF84_RS02450 (MPF84_02450) | comB2 | 503161..503445 (+) | 285 | WP_000736478.1 | TrbC/VirB2 family protein | Machinery gene |
| MPF84_RS02455 (MPF84_02455) | comB3 | 503456..503719 (+) | 264 | WP_001177712.1 | hypothetical protein | Machinery gene |
| MPF84_RS02460 (MPF84_02460) | - | 503730..503966 (+) | 237 | WP_180386948.1 | hypothetical protein | - |
| MPF84_RS02465 (MPF84_02465) | - | 503966..506542 (+) | 2577 | WP_245086302.1 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| MPF84_RS02470 (MPF84_02470) | - | 506539..506679 (+) | 141 | WP_015643441.1 | hypothetical protein | - |
| MPF84_RS02475 (MPF84_02475) | - | 506672..507811 (+) | 1140 | WP_245052287.1 | VirB8/TrbF family protein | - |
| MPF84_RS02480 (MPF84_02480) | - | 507808..509472 (+) | 1665 | WP_180618312.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| MPF84_RS02485 (MPF84_02485) | comB10 | 509469..510668 (+) | 1200 | WP_245086306.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| MPF84_RS02490 (MPF84_02490) | - | 510652..512901 (+) | 2250 | WP_245086309.1 | collagen-like protein | - |
| MPF84_RS02495 (MPF84_02495) | - | 512914..513891 (+) | 978 | WP_245086312.1 | hypothetical protein | - |
| MPF84_RS02500 (MPF84_02500) | - | 513909..514181 (+) | 273 | WP_180671642.1 | hypothetical protein | - |
| MPF84_RS02505 (MPF84_02505) | - | 514186..515130 (+) | 945 | WP_245086315.1 | CpaF/VirB11 family protein | - |
| MPF84_RS02510 (MPF84_02510) | - | 515127..515645 (+) | 519 | WP_120869111.1 | replication regulatory RepB family protein | - |
| MPF84_RS02515 (MPF84_02515) | - | 515642..517906 (+) | 2265 | WP_245086318.1 | type IV secretory system conjugative DNA transfer family protein | - |
| MPF84_RS02520 (MPF84_02520) | - | 517927..519987 (+) | 2061 | WP_245052322.1 | type IA DNA topoisomerase | - |
| MPF84_RS02525 (MPF84_02525) | - | 520042..520512 (+) | 471 | WP_024116506.1 | hypothetical protein | - |
| MPF84_RS02530 (MPF84_02530) | - | 520509..521284 (+) | 776 | Protein_491 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| MPF84_RS02535 (MPF84_02535) | - | 521407..521979 (-) | 573 | WP_245052324.1 | hypothetical protein | - |
| MPF84_RS02540 (MPF84_02540) | - | 521957..522335 (-) | 379 | Protein_493 | hypothetical protein | - |
| MPF84_RS02545 (MPF84_02545) | - | 522397..523047 (-) | 651 | WP_140476845.1 | ParA family protein | - |
| MPF84_RS02550 (MPF84_02550) | - | 523684..523848 (+) | 165 | WP_000189756.1 | hypothetical protein | - |
| MPF84_RS02555 (MPF84_02555) | - | 523849..524916 (+) | 1068 | WP_245052326.1 | ArdC family protein | - |
| MPF84_RS02560 (MPF84_02560) | - | 524916..526682 (+) | 1767 | WP_245086321.1 | hypothetical protein | - |
| MPF84_RS02565 (MPF84_02565) | - | 526692..528125 (+) | 1434 | WP_245052330.1 | toprim domain-containing protein | - |
| MPF84_RS02570 (MPF84_02570) | - | 528122..529372 (+) | 1251 | WP_245052332.1 | P-type conjugative transfer protein TrbL | - |
| MPF84_RS02575 (MPF84_02575) | - | 529369..530625 (+) | 1257 | WP_245052334.1 | hypothetical protein | - |
| MPF84_RS07795 | - | 530647..531376 (-) | 730 | Protein_501 | hypothetical protein | - |
| MPF84_RS02590 (MPF84_02590) | - | 531596..532276 (+) | 681 | WP_245052340.1 | CAAX protease | - |
| MPF84_RS02595 (MPF84_02595) | - | 532408..532659 (+) | 252 | WP_000006537.1 | hypothetical protein | - |
| MPF84_RS02600 (MPF84_02600) | - | 532631..533434 (+) | 804 | WP_000009099.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| MPF84_RS02605 (MPF84_02605) | - | 533752..534819 (-) | 1068 | WP_245052342.1 | tyrosine-type recombinase/integrase | - |
| MPF84_RS02610 (MPF84_02610) | - | 535794..537806 (-) | 2013 | WP_245052344.1 | relaxase/mobilization nuclease domain-containing protein | - |
| MPF84_RS02615 (MPF84_02615) | - | 538783..539719 (+) | 937 | Protein_507 | ATPase | - |
| MPF84_RS02620 (MPF84_02620) | - | 539830..540768 (+) | 939 | WP_245086329.1 | NAD(P)H-dependent glycerol-3-phosphate dehydrogenase | - |
| MPF84_RS02625 (MPF84_02625) | glyQ | 540782..541678 (+) | 897 | WP_001150936.1 | glycine--tRNA ligase subunit alpha | - |
| MPF84_RS02630 (MPF84_02630) | - | 541680..542411 (+) | 732 | WP_245086331.1 | Nif3-like dinuclear metal center hexameric protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10683.00 Da Isoelectric Point: 10.9123
>NTDB_id=667637 MPF84_RS02450 WP_000736478.1 503161..503445(+) (comB2) [Helicobacter pylori strain Hpfe023]
MKKLSHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
MKKLSHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
Nucleotide
Download Length: 285 bp
>NTDB_id=667637 MPF84_RS02450 WP_000736478.1 503161..503445(+) (comB2) [Helicobacter pylori strain Hpfe023]
ATGAAAAAATTAAGTCATTTTAGAAAGCTCATCGCCTTTTTAGGTTTTTCACCACTTTTACTACAAGCGGATATGACTAC
CTTTTTTAATAGTATTGAACAACAACTCACTAGCCCCACCGCTAAGGGTATTTTGATGGTCATTTTTTTAGGGCTTGCTA
TTTTTATATGGAAAAATTTAGACAGATGGAAAGAAATCTTAATGACAGTCCTTGCTATTGCCATAGGAGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAATTGGTTTATGAGTATTTTTTAA
ATGAAAAAATTAAGTCATTTTAGAAAGCTCATCGCCTTTTTAGGTTTTTCACCACTTTTACTACAAGCGGATATGACTAC
CTTTTTTAATAGTATTGAACAACAACTCACTAGCCCCACCGCTAAGGGTATTTTGATGGTCATTTTTTTAGGGCTTGCTA
TTTTTATATGGAAAAATTTAGACAGATGGAAAGAAATCTTAATGACAGTCCTTGCTATTGCCATAGGAGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAATTGGTTTATGAGTATTTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB2 | Helicobacter pylori 26695 |
57.143 |
96.809 |
0.553 |