Detailed information
Overview
| Name | comB3 | Type | Machinery gene |
| Locus tag | MPG31_RS05340 | Genome accession | NZ_CP094074 |
| Coordinates | 1111785..1112048 (+) | Length | 87 a.a. |
| NCBI ID | WP_245015022.1 | Uniprot ID | - |
| Organism | Helicobacter pylori strain Hpfe103 | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1079972..1154043 | 1111785..1112048 | within | 0 |
Gene organization within MGE regions
Location: 1079972..1154043
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MPG31_RS05190 (MPG31_05190) | - | 1080578..1080952 (+) | 375 | WP_000772153.1 | chemotaxis response regulator CheY | - |
| MPG31_RS05195 (MPG31_05195) | prmA | 1080965..1081942 (+) | 978 | WP_245015711.1 | 50S ribosomal protein L11 methyltransferase | - |
| MPG31_RS05200 (MPG31_05200) | ftsH | 1081951..1083849 (+) | 1899 | WP_000805281.1 | ATP-dependent zinc metalloprotease FtsH | - |
| MPG31_RS05205 (MPG31_05205) | - | 1083852..1084106 (+) | 255 | WP_245015005.1 | hypothetical protein | - |
| MPG31_RS05210 (MPG31_05210) | pssA | 1084096..1084809 (+) | 714 | WP_001122213.1 | CDP-diacylglycerol--serine O-phosphatidyltransferase | - |
| MPG31_RS05215 (MPG31_05215) | copA | 1084806..1087031 (+) | 2226 | WP_245015006.1 | copper-translocating P-type ATPase CopA | - |
| MPG31_RS05220 (MPG31_05220) | copP | 1087032..1087232 (+) | 201 | WP_000648265.1 | copper-binding metallochaperone CopP | - |
| MPG31_RS05225 (MPG31_05225) | - | 1087383..1087661 (-) | 279 | WP_245015712.1 | hypothetical protein | - |
| MPG31_RS05230 (MPG31_05230) | csd4 | 1087879..1089189 (-) | 1311 | WP_245015007.1 | M14/M99 family metallopeptidase | - |
| MPG31_RS05235 (MPG31_05235) | - | 1089323..1089838 (+) | 516 | WP_017280178.1 | flagellar FLiS export co-chaperone | - |
| MPG31_RS05240 (MPG31_05240) | - | 1089842..1090837 (-) | 996 | WP_000780448.1 | HoxN/HupN/NixA family nickel/cobalt transporter | - |
| MPG31_RS05245 (MPG31_05245) | - | 1090894..1091590 (-) | 697 | Protein_1022 | DUF3226 domain-containing protein | - |
| MPG31_RS05250 (MPG31_05250) | - | 1091620..1092776 (-) | 1157 | Protein_1023 | ATP/GTP-binding protein | - |
| MPG31_RS05255 (MPG31_05255) | - | 1092887..1093459 (-) | 573 | WP_245015008.1 | restriction endonuclease | - |
| MPG31_RS05260 (MPG31_05260) | - | 1093463..1094086 (-) | 624 | WP_180472076.1 | neuraminyllactose-binding hemagglutinin family protein | - |
| MPG31_RS05265 (MPG31_05265) | - | 1094080..1095744 (-) | 1665 | WP_245015009.1 | ABC transporter ATP-binding protein | - |
| MPG31_RS05270 (MPG31_05270) | hofB | 1095836..1097275 (-) | 1440 | WP_245015010.1 | outer membrane beta-barrel protein HofB | - |
| MPG31_RS05275 (MPG31_05275) | pyrB | 1097585..1098508 (-) | 924 | WP_245015011.1 | aspartate carbamoyltransferase | - |
| MPG31_RS05280 (MPG31_05280) | - | 1098575..1099090 (+) | 516 | WP_245015012.1 | hypothetical protein | - |
| MPG31_RS05285 (MPG31_05285) | - | 1099090..1099797 (+) | 708 | WP_245015013.1 | TlyA family RNA methyltransferase | - |
| MPG31_RS05290 (MPG31_05290) | - | 1099763..1100605 (+) | 843 | WP_245015014.1 | bifunctional riboflavin kinase/FAD synthetase | - |
| MPG31_RS05295 (MPG31_05295) | tkt | 1100652..1102577 (+) | 1926 | WP_245015015.1 | transketolase | - |
| MPG31_RS05300 (MPG31_05300) | - | 1102574..1104910 (+) | 2337 | WP_245015016.1 | PD-(D/E)XK nuclease family protein | - |
| MPG31_RS05305 (MPG31_05305) | - | 1104907..1107423 (+) | 2517 | WP_245015017.1 | DNA translocase FtsK | - |
| MPG31_RS05310 (MPG31_05310) | - | 1107586..1108872 (+) | 1287 | WP_245015018.1 | MFS transporter | - |
| MPG31_RS05315 (MPG31_05315) | - | 1108921..1109730 (+) | 810 | WP_001179215.1 | flagellar hook-basal body protein | - |
| MPG31_RS05320 (MPG31_05320) | - | 1109705..1109990 (-) | 286 | Protein_1037 | hypothetical protein | - |
| MPG31_RS05325 (MPG31_05325) | - | 1110121..1110909 (+) | 789 | WP_245015019.1 | integrase | - |
| MPG31_RS05330 (MPG31_05330) | - | 1111013..1111492 (+) | 480 | WP_245015020.1 | hypothetical protein | - |
| MPG31_RS05335 (MPG31_05335) | comB2 | 1111489..1111773 (+) | 285 | WP_245015021.1 | TrbC/VirB2 family protein | Machinery gene |
| MPG31_RS05340 (MPG31_05340) | comB3 | 1111785..1112048 (+) | 264 | WP_245015022.1 | competence protein ComB | Machinery gene |
| MPG31_RS05345 (MPG31_05345) | - | 1112059..1112295 (+) | 237 | WP_053574506.1 | hypothetical protein | - |
| MPG31_RS05350 (MPG31_05350) | - | 1112295..1114877 (+) | 2583 | WP_245015023.1 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| MPG31_RS05355 (MPG31_05355) | - | 1114874..1115008 (+) | 135 | WP_000738749.1 | hypothetical protein | - |
| MPG31_RS05360 (MPG31_05360) | - | 1115001..1116170 (+) | 1170 | WP_245015024.1 | VirB8/TrbF family protein | - |
| MPG31_RS05365 (MPG31_05365) | - | 1116192..1117838 (+) | 1647 | WP_245015713.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| MPG31_RS05370 (MPG31_05370) | comB10 | 1117835..1119037 (+) | 1203 | WP_212866253.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| MPG31_RS05375 (MPG31_05375) | - | 1119021..1121294 (+) | 2274 | WP_245015025.1 | collagen-like protein | - |
| MPG31_RS05380 (MPG31_05380) | - | 1121294..1122271 (+) | 978 | WP_245015026.1 | hypothetical protein | - |
| MPG31_RS05385 (MPG31_05385) | - | 1122289..1122558 (+) | 270 | WP_245015027.1 | hypothetical protein | - |
| MPG31_RS05390 (MPG31_05390) | - | 1122563..1123507 (+) | 945 | WP_154569831.1 | CpaF/VirB11 family protein | - |
| MPG31_RS05395 (MPG31_05395) | - | 1123504..1124022 (+) | 519 | WP_245015028.1 | replication regulatory RepB family protein | - |
| MPG31_RS05400 (MPG31_05400) | - | 1124019..1126283 (+) | 2265 | WP_245015029.1 | type IV secretory system conjugative DNA transfer family protein | - |
| MPG31_RS05405 (MPG31_05405) | - | 1126303..1134870 (+) | 8568 | WP_245015030.1 | SNF2-related protein | - |
| MPG31_RS05410 (MPG31_05410) | - | 1135244..1136008 (+) | 765 | Protein_1055 | DNA topoisomerase | - |
| MPG31_RS05415 (MPG31_05415) | - | 1136002..1136079 (-) | 78 | Protein_1056 | division plane positioning ATPase MipZ | - |
| MPG31_RS05420 (MPG31_05420) | - | 1136716..1136880 (+) | 165 | WP_021301014.1 | hypothetical protein | - |
| MPG31_RS05425 (MPG31_05425) | - | 1136881..1137933 (+) | 1053 | WP_245015031.1 | ArdC-like ssDNA-binding domain-containing protein | - |
| MPG31_RS05430 (MPG31_05430) | - | 1137933..1139819 (+) | 1887 | WP_245015032.1 | hypothetical protein | - |
| MPG31_RS05435 (MPG31_05435) | - | 1139829..1141262 (+) | 1434 | WP_039704298.1 | hypothetical protein | - |
| MPG31_RS05440 (MPG31_05440) | - | 1141259..1142509 (+) | 1251 | WP_180636615.1 | P-type conjugative transfer protein TrbL | - |
| MPG31_RS05445 (MPG31_05445) | - | 1142506..1143762 (+) | 1257 | WP_245015033.1 | hypothetical protein | - |
| MPG31_RS05450 (MPG31_05450) | - | 1143784..1144494 (-) | 711 | WP_245015034.1 | hypothetical protein | - |
| MPG31_RS05455 (MPG31_05455) | - | 1144731..1145410 (+) | 680 | Protein_1064 | CAAX protease | - |
| MPG31_RS05460 (MPG31_05460) | - | 1145542..1145793 (+) | 252 | WP_000006537.1 | hypothetical protein | - |
| MPG31_RS05465 (MPG31_05465) | - | 1145765..1146568 (+) | 804 | WP_000009099.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| MPG31_RS05470 (MPG31_05470) | - | 1146886..1147953 (-) | 1068 | WP_064429940.1 | tyrosine-type recombinase/integrase | - |
| MPG31_RS05475 (MPG31_05475) | - | 1149109..1151142 (-) | 2034 | WP_245015035.1 | relaxase | - |
| MPG31_RS05480 (MPG31_05480) | - | 1152095..1152303 (-) | 209 | Protein_1069 | hypothetical protein | - |
| MPG31_RS05485 (MPG31_05485) | - | 1152306..1153064 (-) | 759 | WP_001052065.1 | DUF3883 domain-containing protein | - |
Sequence
Protein
Download Length: 87 a.a. Molecular weight: 9946.83 Da Isoelectric Point: 6.4477
>NTDB_id=666461 MPG31_RS05340 WP_245015022.1 1111785..1112048(+) (comB3) [Helicobacter pylori strain Hpfe103]
MQLVGISVSNLKEISSKEKFLWLNAKSFLIAGFIPFVMIPWLDFLNSLMLHVCFLLVFSIAEFFDEDISDILIAHSKIKT
KANSFYA
MQLVGISVSNLKEISSKEKFLWLNAKSFLIAGFIPFVMIPWLDFLNSLMLHVCFLLVFSIAEFFDEDISDILIAHSKIKT
KANSFYA
Nucleotide
Download Length: 264 bp
>NTDB_id=666461 MPG31_RS05340 WP_245015022.1 1111785..1112048(+) (comB3) [Helicobacter pylori strain Hpfe103]
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGCTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
TTTTTTAATCGCAGGATTTATTCCTTTTGTAATGATACCTTGGCTAGATTTTTTAAATTCTTTAATGCTGCATGTGTGCT
TTTTATTGGTTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGTGACATTTTAATCGCTCATTCCAAAATTAAAACC
AAAGCTAATTCATTTTACGCTTAA
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGCTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
TTTTTTAATCGCAGGATTTATTCCTTTTGTAATGATACCTTGGCTAGATTTTTTAAATTCTTTAATGCTGCATGTGTGCT
TTTTATTGGTTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGTGACATTTTAATCGCTCATTCCAAAATTAAAACC
AAAGCTAATTCATTTTACGCTTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB3 | Helicobacter pylori 26695 |
57.471 |
100 |
0.575 |