Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB3   Type   Machinery gene
Locus tag   MPG31_RS05340 Genome accession   NZ_CP094074
Coordinates   1111785..1112048 (+) Length   87 a.a.
NCBI ID   WP_245015022.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hpfe103     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1079972..1154043 1111785..1112048 within 0


Gene organization within MGE regions


Location: 1079972..1154043
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG31_RS05190 (MPG31_05190) - 1080578..1080952 (+) 375 WP_000772153.1 chemotaxis response regulator CheY -
  MPG31_RS05195 (MPG31_05195) prmA 1080965..1081942 (+) 978 WP_245015711.1 50S ribosomal protein L11 methyltransferase -
  MPG31_RS05200 (MPG31_05200) ftsH 1081951..1083849 (+) 1899 WP_000805281.1 ATP-dependent zinc metalloprotease FtsH -
  MPG31_RS05205 (MPG31_05205) - 1083852..1084106 (+) 255 WP_245015005.1 hypothetical protein -
  MPG31_RS05210 (MPG31_05210) pssA 1084096..1084809 (+) 714 WP_001122213.1 CDP-diacylglycerol--serine O-phosphatidyltransferase -
  MPG31_RS05215 (MPG31_05215) copA 1084806..1087031 (+) 2226 WP_245015006.1 copper-translocating P-type ATPase CopA -
  MPG31_RS05220 (MPG31_05220) copP 1087032..1087232 (+) 201 WP_000648265.1 copper-binding metallochaperone CopP -
  MPG31_RS05225 (MPG31_05225) - 1087383..1087661 (-) 279 WP_245015712.1 hypothetical protein -
  MPG31_RS05230 (MPG31_05230) csd4 1087879..1089189 (-) 1311 WP_245015007.1 M14/M99 family metallopeptidase -
  MPG31_RS05235 (MPG31_05235) - 1089323..1089838 (+) 516 WP_017280178.1 flagellar FLiS export co-chaperone -
  MPG31_RS05240 (MPG31_05240) - 1089842..1090837 (-) 996 WP_000780448.1 HoxN/HupN/NixA family nickel/cobalt transporter -
  MPG31_RS05245 (MPG31_05245) - 1090894..1091590 (-) 697 Protein_1022 DUF3226 domain-containing protein -
  MPG31_RS05250 (MPG31_05250) - 1091620..1092776 (-) 1157 Protein_1023 ATP/GTP-binding protein -
  MPG31_RS05255 (MPG31_05255) - 1092887..1093459 (-) 573 WP_245015008.1 restriction endonuclease -
  MPG31_RS05260 (MPG31_05260) - 1093463..1094086 (-) 624 WP_180472076.1 neuraminyllactose-binding hemagglutinin family protein -
  MPG31_RS05265 (MPG31_05265) - 1094080..1095744 (-) 1665 WP_245015009.1 ABC transporter ATP-binding protein -
  MPG31_RS05270 (MPG31_05270) hofB 1095836..1097275 (-) 1440 WP_245015010.1 outer membrane beta-barrel protein HofB -
  MPG31_RS05275 (MPG31_05275) pyrB 1097585..1098508 (-) 924 WP_245015011.1 aspartate carbamoyltransferase -
  MPG31_RS05280 (MPG31_05280) - 1098575..1099090 (+) 516 WP_245015012.1 hypothetical protein -
  MPG31_RS05285 (MPG31_05285) - 1099090..1099797 (+) 708 WP_245015013.1 TlyA family RNA methyltransferase -
  MPG31_RS05290 (MPG31_05290) - 1099763..1100605 (+) 843 WP_245015014.1 bifunctional riboflavin kinase/FAD synthetase -
  MPG31_RS05295 (MPG31_05295) tkt 1100652..1102577 (+) 1926 WP_245015015.1 transketolase -
  MPG31_RS05300 (MPG31_05300) - 1102574..1104910 (+) 2337 WP_245015016.1 PD-(D/E)XK nuclease family protein -
  MPG31_RS05305 (MPG31_05305) - 1104907..1107423 (+) 2517 WP_245015017.1 DNA translocase FtsK -
  MPG31_RS05310 (MPG31_05310) - 1107586..1108872 (+) 1287 WP_245015018.1 MFS transporter -
  MPG31_RS05315 (MPG31_05315) - 1108921..1109730 (+) 810 WP_001179215.1 flagellar hook-basal body protein -
  MPG31_RS05320 (MPG31_05320) - 1109705..1109990 (-) 286 Protein_1037 hypothetical protein -
  MPG31_RS05325 (MPG31_05325) - 1110121..1110909 (+) 789 WP_245015019.1 integrase -
  MPG31_RS05330 (MPG31_05330) - 1111013..1111492 (+) 480 WP_245015020.1 hypothetical protein -
  MPG31_RS05335 (MPG31_05335) comB2 1111489..1111773 (+) 285 WP_245015021.1 TrbC/VirB2 family protein Machinery gene
  MPG31_RS05340 (MPG31_05340) comB3 1111785..1112048 (+) 264 WP_245015022.1 competence protein ComB Machinery gene
  MPG31_RS05345 (MPG31_05345) - 1112059..1112295 (+) 237 WP_053574506.1 hypothetical protein -
  MPG31_RS05350 (MPG31_05350) - 1112295..1114877 (+) 2583 WP_245015023.1 VirB4 family type IV secretion/conjugal transfer ATPase -
  MPG31_RS05355 (MPG31_05355) - 1114874..1115008 (+) 135 WP_000738749.1 hypothetical protein -
  MPG31_RS05360 (MPG31_05360) - 1115001..1116170 (+) 1170 WP_245015024.1 VirB8/TrbF family protein -
  MPG31_RS05365 (MPG31_05365) - 1116192..1117838 (+) 1647 WP_245015713.1 TrbG/VirB9 family P-type conjugative transfer protein -
  MPG31_RS05370 (MPG31_05370) comB10 1117835..1119037 (+) 1203 WP_212866253.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG31_RS05375 (MPG31_05375) - 1119021..1121294 (+) 2274 WP_245015025.1 collagen-like protein -
  MPG31_RS05380 (MPG31_05380) - 1121294..1122271 (+) 978 WP_245015026.1 hypothetical protein -
  MPG31_RS05385 (MPG31_05385) - 1122289..1122558 (+) 270 WP_245015027.1 hypothetical protein -
  MPG31_RS05390 (MPG31_05390) - 1122563..1123507 (+) 945 WP_154569831.1 CpaF/VirB11 family protein -
  MPG31_RS05395 (MPG31_05395) - 1123504..1124022 (+) 519 WP_245015028.1 replication regulatory RepB family protein -
  MPG31_RS05400 (MPG31_05400) - 1124019..1126283 (+) 2265 WP_245015029.1 type IV secretory system conjugative DNA transfer family protein -
  MPG31_RS05405 (MPG31_05405) - 1126303..1134870 (+) 8568 WP_245015030.1 SNF2-related protein -
  MPG31_RS05410 (MPG31_05410) - 1135244..1136008 (+) 765 Protein_1055 DNA topoisomerase -
  MPG31_RS05415 (MPG31_05415) - 1136002..1136079 (-) 78 Protein_1056 division plane positioning ATPase MipZ -
  MPG31_RS05420 (MPG31_05420) - 1136716..1136880 (+) 165 WP_021301014.1 hypothetical protein -
  MPG31_RS05425 (MPG31_05425) - 1136881..1137933 (+) 1053 WP_245015031.1 ArdC-like ssDNA-binding domain-containing protein -
  MPG31_RS05430 (MPG31_05430) - 1137933..1139819 (+) 1887 WP_245015032.1 hypothetical protein -
  MPG31_RS05435 (MPG31_05435) - 1139829..1141262 (+) 1434 WP_039704298.1 hypothetical protein -
  MPG31_RS05440 (MPG31_05440) - 1141259..1142509 (+) 1251 WP_180636615.1 P-type conjugative transfer protein TrbL -
  MPG31_RS05445 (MPG31_05445) - 1142506..1143762 (+) 1257 WP_245015033.1 hypothetical protein -
  MPG31_RS05450 (MPG31_05450) - 1143784..1144494 (-) 711 WP_245015034.1 hypothetical protein -
  MPG31_RS05455 (MPG31_05455) - 1144731..1145410 (+) 680 Protein_1064 CAAX protease -
  MPG31_RS05460 (MPG31_05460) - 1145542..1145793 (+) 252 WP_000006537.1 hypothetical protein -
  MPG31_RS05465 (MPG31_05465) - 1145765..1146568 (+) 804 WP_000009099.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  MPG31_RS05470 (MPG31_05470) - 1146886..1147953 (-) 1068 WP_064429940.1 tyrosine-type recombinase/integrase -
  MPG31_RS05475 (MPG31_05475) - 1149109..1151142 (-) 2034 WP_245015035.1 relaxase -
  MPG31_RS05480 (MPG31_05480) - 1152095..1152303 (-) 209 Protein_1069 hypothetical protein -
  MPG31_RS05485 (MPG31_05485) - 1152306..1153064 (-) 759 WP_001052065.1 DUF3883 domain-containing protein -

Sequence


Protein


Download         Length: 87 a.a.        Molecular weight: 9946.83 Da        Isoelectric Point: 6.4477

>NTDB_id=666461 MPG31_RS05340 WP_245015022.1 1111785..1112048(+) (comB3) [Helicobacter pylori strain Hpfe103]
MQLVGISVSNLKEISSKEKFLWLNAKSFLIAGFIPFVMIPWLDFLNSLMLHVCFLLVFSIAEFFDEDISDILIAHSKIKT
KANSFYA

Nucleotide


Download         Length: 264 bp        

>NTDB_id=666461 MPG31_RS05340 WP_245015022.1 1111785..1112048(+) (comB3) [Helicobacter pylori strain Hpfe103]
ATGCAATTAGTTGGTATTTCAGTTTCTAATCTCAAAGAAATCAGCTCCAAAGAAAAATTTCTTTGGCTCAATGCTAAGAG
TTTTTTAATCGCAGGATTTATTCCTTTTGTAATGATACCTTGGCTAGATTTTTTAAATTCTTTAATGCTGCATGTGTGCT
TTTTATTGGTTTTTAGCATAGCGGAGTTCTTTGATGAAGATATAAGTGACATTTTAATCGCTCATTCCAAAATTAAAACC
AAAGCTAATTCATTTTACGCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB3 Helicobacter pylori 26695

57.471

100

0.575