Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   MID02_RS12170 Genome accession   NZ_CP092383
Coordinates   2555623..2555937 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain SF327     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2550623..2560937
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MID02_RS12125 (MID02_12125) sinI 2551306..2551479 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  MID02_RS12130 (MID02_12130) sinR 2551513..2551848 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MID02_RS12135 (MID02_12135) - 2551896..2552681 (-) 786 WP_003153102.1 TasA family protein -
  MID02_RS12140 (MID02_12140) - 2552745..2553329 (-) 585 WP_012117977.1 signal peptidase I -
  MID02_RS12145 (MID02_12145) tapA 2553301..2553972 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  MID02_RS12150 (MID02_12150) - 2554231..2554560 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  MID02_RS12155 (MID02_12155) - 2554600..2554779 (-) 180 WP_003153093.1 YqzE family protein -
  MID02_RS12160 (MID02_12160) comGG 2554836..2555213 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  MID02_RS12165 (MID02_12165) comGF 2555214..2555609 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  MID02_RS12170 (MID02_12170) comGE 2555623..2555937 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  MID02_RS12175 (MID02_12175) comGD 2555921..2556358 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  MID02_RS12180 (MID02_12180) comGC 2556348..2556656 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  MID02_RS12185 (MID02_12185) comGB 2556661..2557698 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  MID02_RS12190 (MID02_12190) comGA 2557685..2558755 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  MID02_RS12195 (MID02_12195) - 2558947..2559897 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=657039 MID02_RS12170 WP_015388003.1 2555623..2555937(-) (comGE) [Bacillus velezensis strain SF327]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=657039 MID02_RS12170 WP_015388003.1 2555623..2555937(-) (comGE) [Bacillus velezensis strain SF327]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481