Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   MF598_RS07895 Genome accession   NZ_CP092185
Coordinates   1516552..1516818 (+) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain K203     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1511552..1521818
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MF598_RS07875 (MF598_07875) - 1511822..1513123 (-) 1302 WP_039063318.1 hemolysin family protein -
  MF598_RS07880 (MF598_07880) - 1513269..1514219 (+) 951 WP_015417820.1 magnesium transporter CorA family protein -
  MF598_RS07885 (MF598_07885) comGA 1514411..1515481 (+) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  MF598_RS07890 (MF598_07890) comGB 1515468..1516505 (+) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  MF598_RS07895 (MF598_07895) comGC 1516552..1516818 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  MF598_RS07900 (MF598_07900) comGD 1516808..1517245 (+) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  MF598_RS07905 (MF598_07905) comGE 1517229..1517543 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  MF598_RS07910 (MF598_07910) comGF 1517452..1517952 (+) 501 WP_258038902.1 competence type IV pilus minor pilin ComGF -
  MF598_RS07915 (MF598_07915) comGG 1517953..1518330 (+) 378 WP_039063315.1 competence type IV pilus minor pilin ComGG -
  MF598_RS07920 (MF598_07920) - 1518387..1518566 (+) 180 WP_003153093.1 YqzE family protein -
  MF598_RS07925 (MF598_07925) - 1518606..1518935 (-) 330 WP_020954231.1 DUF3889 domain-containing protein -
  MF598_RS07930 (MF598_07930) tapA 1519194..1519865 (+) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  MF598_RS07935 (MF598_07935) - 1519837..1520421 (+) 585 WP_007408328.1 signal peptidase I -
  MF598_RS07940 (MF598_07940) - 1520486..1521271 (+) 786 WP_007408329.1 TasA family protein -
  MF598_RS07945 (MF598_07945) sinR 1521319..1521654 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=656250 MF598_RS07895 WP_042635730.1 1516552..1516818(+) (comGC) [Bacillus velezensis strain K203]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=656250 MF598_RS07895 WP_042635730.1 1516552..1516818(+) (comGC) [Bacillus velezensis strain K203]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602