Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   LZ603_RS18755 Genome accession   NZ_CP090421
Coordinates   3766858..3767637 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain NR1     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3741565..3803323 3766858..3767637 within 0


Gene organization within MGE regions


Location: 3741565..3803323
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LZ603_RS18645 - 3742135..3743034 (-) 900 WP_000868217.1 polysaccharide deacetylase family protein -
  LZ603_RS18650 pnp 3743186..3745324 (-) 2139 WP_000076737.1 polyribonucleotide nucleotidyltransferase -
  LZ603_RS18655 rpsO 3745485..3745754 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  LZ603_RS18660 ribF 3745855..3746826 (-) 972 WP_000766706.1 bifunctional riboflavin kinase/FAD synthetase -
  LZ603_RS18665 truB 3746870..3747793 (-) 924 WP_000399352.1 tRNA pseudouridine(55) synthase TruB -
  LZ603_RS18670 rbfA 3747880..3748236 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  LZ603_RS18675 - 3748252..3748533 (-) 282 WP_000582363.1 DUF503 family protein -
  LZ603_RS18680 infB 3748530..3750590 (-) 2061 WP_000036343.1 translation initiation factor IF-2 -
  LZ603_RS18685 - 3750595..3750906 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  LZ603_RS18690 - 3750907..3751179 (-) 273 WP_000071127.1 YlxR family protein -
  LZ603_RS18695 nusA 3751191..3752297 (-) 1107 WP_000102604.1 transcription termination factor NusA -
  LZ603_RS18700 rimP 3752315..3752785 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  LZ603_RS18705 - 3753122..3757423 (-) 4302 WP_000060005.1 PolC-type DNA polymerase III -
  LZ603_RS18710 - 3757548..3759248 (-) 1701 WP_000814299.1 proline--tRNA ligase -
  LZ603_RS18715 rseP 3759358..3760614 (-) 1257 WP_001090243.1 RIP metalloprotease RseP -
  LZ603_RS18720 dxr 3760632..3761774 (-) 1143 WP_000790373.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  LZ603_RS18725 cdsA 3761798..3762589 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  LZ603_RS18730 uppS 3762607..3763383 (-) 777 WP_234574204.1 isoprenyl transferase -
  LZ603_RS18735 frr 3763469..3764026 (-) 558 WP_000531501.1 ribosome recycling factor -
  LZ603_RS18740 pyrH 3764029..3764751 (-) 723 WP_000042668.1 UMP kinase -
  LZ603_RS18745 tsf 3764818..3765705 (-) 888 WP_001018578.1 translation elongation factor Ts -
  LZ603_RS18750 rpsB 3765809..3766510 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  LZ603_RS18755 codY 3766858..3767637 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  LZ603_RS18760 hslU 3767715..3769106 (-) 1392 WP_000550078.1 ATP-dependent protease ATPase subunit HslU -
  LZ603_RS18765 hslV 3769129..3769671 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  LZ603_RS18770 xerC 3769714..3770613 (-) 900 WP_001101243.1 tyrosine recombinase XerC -
  LZ603_RS18775 trmFO 3770679..3771983 (-) 1305 WP_000213002.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  LZ603_RS18780 topA 3772032..3774110 (-) 2079 WP_001286963.1 type I DNA topoisomerase -
  LZ603_RS18785 dprA 3774255..3775124 (-) 870 WP_071741405.1 DNA-processing protein DprA -
  LZ603_RS18790 sucD 3775213..3776115 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  LZ603_RS18795 sucC 3776135..3777295 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  LZ603_RS18800 - 3777490..3778263 (-) 774 WP_001194265.1 ribonuclease HII -
  LZ603_RS18805 ylqF 3778320..3779210 (-) 891 WP_000236704.1 ribosome biogenesis GTPase YlqF -
  LZ603_RS18810 lepB 3779231..3779782 (-) 552 WP_000711853.1 signal peptidase I -
  LZ603_RS18815 rplS 3779884..3780228 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  LZ603_RS18820 trmD 3780375..3781109 (-) 735 WP_086400993.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  LZ603_RS18825 rimM 3781109..3781624 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  LZ603_RS18830 - 3781746..3781973 (-) 228 WP_000737401.1 KH domain-containing protein -
  LZ603_RS18835 rpsP 3781988..3782260 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  LZ603_RS18840 ffh 3782362..3783711 (-) 1350 WP_075717459.1 signal recognition particle protein -
  LZ603_RS18845 - 3783724..3784056 (-) 333 WP_000891062.1 putative DNA-binding protein -
  LZ603_RS18850 ftsY 3784190..3785179 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  LZ603_RS18855 smc 3785195..3788764 (-) 3570 WP_234574205.1 chromosome segregation protein SMC -
  LZ603_RS18860 rncS 3788911..3789648 (-) 738 WP_001146875.1 ribonuclease III -
  LZ603_RS18865 acpP 3789707..3789940 (-) 234 WP_000786062.1 acyl carrier protein -
  LZ603_RS18870 fabG 3790010..3790750 (-) 741 WP_000911773.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  LZ603_RS18875 fabD 3790750..3791694 (-) 945 WP_000515899.1 ACP S-malonyltransferase -
  LZ603_RS18880 plsX 3791709..3792701 (-) 993 WP_000684100.1 phosphate acyltransferase PlsX -
  LZ603_RS18885 fapR 3792698..3793291 (-) 594 WP_000747348.1 transcription factor FapR -
  LZ603_RS18890 recG 3793380..3795428 (-) 2049 WP_001000816.1 ATP-dependent DNA helicase RecG -
  LZ603_RS18895 - 3795719..3797395 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  LZ603_RS18900 - 3797418..3797780 (-) 363 WP_002173116.1 Asp23/Gls24 family envelope stress response protein -
  LZ603_RS18905 rpmB 3798157..3798345 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  LZ603_RS18910 spoVM 3798419..3798499 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  LZ603_RS18915 - 3798566..3799246 (-) 681 WP_002026234.1 thiamine diphosphokinase -
  LZ603_RS18920 rpe 3799315..3799959 (-) 645 WP_000589974.1 ribulose-phosphate 3-epimerase -
  LZ603_RS18925 rsgA 3799962..3800843 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  LZ603_RS18930 pknB 3801090..3803063 (-) 1974 WP_000904747.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=642260 LZ603_RS18755 WP_000421290.1 3766858..3767637(-) (codY) [Bacillus cereus strain NR1]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=642260 LZ603_RS18755 WP_000421290.1 3766858..3767637(-) (codY) [Bacillus cereus strain NR1]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCGCGTAGTAAAGCTGTTGTTCAAATGGCAATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTACTAAACGACAAGTTTCTACAAGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459