Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   LKW29_RS16000 Genome accession   NZ_CP089993
Coordinates   3108484..3109263 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus anthracis strain BF5     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3074163..3148087 3108484..3109263 within 0


Gene organization within MGE regions


Location: 3074163..3148087
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LKW29_RS15850 (LKW29_15850) - 3074506..3076176 (-) 1671 WP_000823085.1 ribonuclease J -
  LKW29_RS15855 (LKW29_15855) dapA 3076942..3077820 (-) 879 WP_000564767.1 4-hydroxy-tetrahydrodipicolinate synthase -
  LKW29_RS15860 (LKW29_15860) dapG 3077832..3079064 (-) 1233 WP_000692470.1 aspartate kinase -
  LKW29_RS15865 (LKW29_15865) asd 3079088..3080134 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  LKW29_RS15870 (LKW29_15870) dpaB 3080285..3080884 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  LKW29_RS15875 (LKW29_15875) dpaA 3080881..3081783 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  LKW29_RS15880 (LKW29_15880) - 3082058..3082309 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  LKW29_RS15885 (LKW29_15885) - 3082436..3083677 (-) 1242 WP_000592993.1 pitrilysin family protein -
  LKW29_RS15890 (LKW29_15890) - 3083764..3084663 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  LKW29_RS15895 (LKW29_15895) pnp 3084814..3086952 (-) 2139 WP_000076750.1 polyribonucleotide nucleotidyltransferase -
  LKW29_RS15900 (LKW29_15900) rpsO 3087113..3087382 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  LKW29_RS15905 (LKW29_15905) ribF 3087483..3088454 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  LKW29_RS15910 (LKW29_15910) truB 3088498..3089421 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  LKW29_RS15915 (LKW29_15915) rbfA 3089508..3089864 (-) 357 WP_000776441.1 30S ribosome-binding factor RbfA -
  LKW29_RS15920 (LKW29_15920) - 3089880..3090161 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  LKW29_RS15925 (LKW29_15925) infB 3090158..3092218 (-) 2061 WP_000036340.1 translation initiation factor IF-2 -
  LKW29_RS15930 (LKW29_15930) - 3092223..3092534 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  LKW29_RS15935 (LKW29_15935) rnpM 3092535..3092807 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  LKW29_RS15940 (LKW29_15940) nusA 3092819..3093925 (-) 1107 WP_000102606.1 transcription termination factor NusA -
  LKW29_RS15945 (LKW29_15945) rimP 3093943..3094413 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  LKW29_RS15950 (LKW29_15950) - 3094746..3099047 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  LKW29_RS15955 (LKW29_15955) - 3099172..3100872 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  LKW29_RS15960 (LKW29_15960) rseP 3100982..3102238 (-) 1257 WP_001090228.1 RIP metalloprotease RseP -
  LKW29_RS15965 (LKW29_15965) dxr 3102255..3103397 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  LKW29_RS15970 (LKW29_15970) cdsA 3103421..3104212 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  LKW29_RS15975 (LKW29_15975) uppS 3104230..3105006 (-) 777 WP_000971301.1 isoprenyl transferase -
  LKW29_RS15980 (LKW29_15980) frr 3105092..3105649 (-) 558 WP_000531503.1 ribosome recycling factor -
  LKW29_RS15985 (LKW29_15985) pyrH 3105652..3106374 (-) 723 WP_000042663.1 UMP kinase -
  LKW29_RS15990 (LKW29_15990) tsf 3106441..3107328 (-) 888 WP_001018581.1 translation elongation factor Ts -
  LKW29_RS15995 (LKW29_15995) rpsB 3107432..3108133 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  LKW29_RS16000 (LKW29_16000) codY 3108484..3109263 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  LKW29_RS16005 (LKW29_16005) hslU 3109341..3110732 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  LKW29_RS16010 (LKW29_16010) hslV 3110755..3111297 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  LKW29_RS16015 (LKW29_16015) xerC 3111340..3112239 (-) 900 WP_001101226.1 tyrosine recombinase XerC -
  LKW29_RS16020 (LKW29_16020) trmFO 3112305..3113609 (-) 1305 WP_001991958.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  LKW29_RS16025 (LKW29_16025) topA 3113660..3115738 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  LKW29_RS16030 (LKW29_16030) dprA 3115883..3116631 (-) 749 Protein_3182 DNA-processing protein DprA -
  LKW29_RS16035 (LKW29_16035) sucD 3116839..3117741 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  LKW29_RS16040 (LKW29_16040) sucC 3117762..3118922 (-) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  LKW29_RS16045 (LKW29_16045) rnhB 3119117..3119890 (-) 774 WP_001174712.1 ribonuclease HII -
  LKW29_RS16050 (LKW29_16050) ylqF 3119942..3120832 (-) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  LKW29_RS16055 (LKW29_16055) lepB 3120853..3121404 (-) 552 WP_000711857.1 signal peptidase I -
  LKW29_RS16060 (LKW29_16060) rplS 3121506..3121850 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  LKW29_RS16065 (LKW29_16065) trmD 3121997..3122731 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  LKW29_RS16070 (LKW29_16070) rimM 3122731..3123246 (-) 516 WP_000170269.1 ribosome maturation factor RimM -
  LKW29_RS16075 (LKW29_16075) - 3123367..3123594 (-) 228 WP_000737398.1 KH domain-containing protein -
  LKW29_RS16080 (LKW29_16080) rpsP 3123609..3123881 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  LKW29_RS16085 (LKW29_16085) ffh 3123982..3125331 (-) 1350 WP_000863456.1 signal recognition particle protein -
  LKW29_RS16090 (LKW29_16090) - 3125344..3125676 (-) 333 WP_000891062.1 putative DNA-binding protein -
  LKW29_RS16095 (LKW29_16095) ftsY 3125810..3126799 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  LKW29_RS16100 (LKW29_16100) smc 3126815..3130384 (-) 3570 WP_000478986.1 chromosome segregation protein SMC -
  LKW29_RS16105 (LKW29_16105) rncS 3130531..3131268 (-) 738 WP_001146873.1 ribonuclease III -
  LKW29_RS16110 (LKW29_16110) acpP 3131327..3131560 (-) 234 WP_000786062.1 acyl carrier protein -
  LKW29_RS16115 (LKW29_16115) fabG 3131630..3132370 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  LKW29_RS16120 (LKW29_16120) fabD 3132370..3133314 (-) 945 WP_000516957.1 ACP S-malonyltransferase -
  LKW29_RS16125 (LKW29_16125) plsX 3133329..3134321 (-) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  LKW29_RS16130 (LKW29_16130) fapR 3134318..3134917 (-) 600 WP_233737138.1 transcription factor FapR -
  LKW29_RS16135 (LKW29_16135) recG 3134999..3137047 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  LKW29_RS16140 (LKW29_16140) - 3137337..3139013 (-) 1677 WP_000027140.1 DAK2 domain-containing protein -
  LKW29_RS16145 (LKW29_16145) - 3139036..3139398 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  LKW29_RS16150 (LKW29_16150) rpmB 3139777..3139965 (+) 189 WP_000124778.1 50S ribosomal protein L28 -
  LKW29_RS16155 (LKW29_16155) spoVM 3140039..3140119 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  LKW29_RS16160 (LKW29_16160) - 3140186..3140866 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  LKW29_RS16165 (LKW29_16165) rpe 3140966..3141610 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  LKW29_RS16170 (LKW29_16170) rsgA 3141613..3142494 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  LKW29_RS16175 (LKW29_16175) prkC 3142763..3144736 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  LKW29_RS16180 (LKW29_16180) - 3144745..3145497 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  LKW29_RS16185 (LKW29_16185) rlmN 3145502..3146590 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  LKW29_RS16190 (LKW29_16190) rsmB 3146595..3147929 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=639786 LKW29_RS16000 WP_000421288.1 3108484..3109263(-) (codY) [Bacillus anthracis strain BF5]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=639786 LKW29_RS16000 WP_000421288.1 3108484..3109263(-) (codY) [Bacillus anthracis strain BF5]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459