Detailed information    

experimental Experimentally validated

Overview

Name   subA/fin   Type   Machinery gene
Locus tag   BSU_00540 Genome accession   NC_000964
Coordinates   60130..60360 (+) Length   76 a.a.
NCBI ID   NP_387935.1    Uniprot ID   P37553
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   homologous recombination   
Homologous recombination

Function

SubA proteins might play a role in the stabilization and or processing of HJ intermediates. The Delta sms and Delta subA mutations, which partially suppressed the recombinational repair phenotype of mutants for functions within epistatic group epsilon, enhanced plasmid transformation of recU (recB, recD) and recS cells by 10- to 20-fold.


Genomic Context

Location: 55130..65360
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_00480 (BSU00480) ridA 55295..55672 (+) 378 NP_387929.1 aminoacrylate/iminopropionate hydrolase/deaminase -
  BSU_00490 (BSU00490) spoVG 55866..56159 (+) 294 NP_387930.1 regulator required for spore cortex synthesis (stage V sporulation) -
  BSU_00500 (BSU00500) glmU 56352..57722 (+) 1371 NP_387931.1 bifunctional glucosamine-1-phosphate N-acetyltransferase/UDP-N-acetylglucosamine pyrophosphorylase -
  BSU_00510 (BSU00510) prs 57745..58698 (+) 954 NP_387932.1 phosphoribosylpyrophosphate synthetase -
  BSU_00520 (BSU00520) ctc 58783..59397 (+) 615 NP_387933.1 ribosomal protein BL25 (Ctc), binding 5S RNA -
  BSU_00530 (BSU00530) pth 59504..60070 (+) 567 NP_387934.1 peptidyl-tRNA hydrolase -
  BSU_00540 (BSU00540) subA/fin 60130..60360 (+) 231 NP_387935.1 protein required for the switch from F to G during sporulation (anti sigma F) Machinery gene
  BSU_00550 (BSU00550) mfd 60430..63963 (+) 3534 NP_387936.1 transcription-repair coupling factor -
  BSU_00560 (BSU00560) spoVT 64099..64635 (+) 537 NP_387937.1 transcriptional regulator of sporulation / germination -

Sequence

Protein


Download         Length: 76 a.a.        Molecular weight: 8847.81 Da        Isoelectric Point: 5.3895

>NTDB_id=636 BSU_00540 NP_387935.1 60130..60360(+) (subA/fin) [Bacillus subtilis subsp. subtilis str. 168]
MALHYYCRHCGVKVGSLESSMVSTDSLGFQHLTNEERNDMISYKENGDVHVLTICEDCQEALDRNPHYHEYHTFIQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=636 BSU_00540 NP_387935.1 60130..60360(+) (subA/fin) [Bacillus subtilis subsp. subtilis str. 168]
ATGGCTTTGCATTATTATTGTCGTCATTGCGGAGTGAAAGTAGGCAGTCTCGAATCTTCAATGGTATCGACAGACTCACT
TGGATTTCAGCACTTAACAAATGAGGAAAGAAACGATATGATTTCTTATAAAGAAAATGGAGATGTCCATGTTTTGACGA
TATGTGAAGACTGCCAAGAGGCGCTTGACCGAAATCCGCATTACCACGAATATCACACATTTATTCAATAA

Domains

Predicted by InterProScan.

Anti-sigma-F factor Fin (Fin)

(1-76)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  PDB 5MSL

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Begoña Carrasco et al. (2004) Genetic recombination in Bacillus subtilis 168: contribution of Holliday junction processing functions in chromosome segregation. Journal of Bacteriology 186(17):5557-66. [PMID: 15317759]
[2] B Carrasco et al. (2002) Effect of the recU suppressors sms and subA on DNA repair and homologous recombination in Bacillus subtilis. Molecular Genetics And Genomics : MGG 266(5):899-906. [PMID: 11810266]