Detailed information    

experimental Experimentally validated

Overview

Name   htkA   Type   Unclear
Locus tag   TK_RS07015 Genome accession   NC_006624
Coordinates   1239730..1239933 (-) Length   67 a.a.
NCBI ID   WP_011250364.1    Uniprot ID   Q9Y8I1
Organism   Thermococcus kodakarensis KOD1     
Function   require for natural transformation   
Unclear

Function

The deletion of TK1413 (ΔhtkA) resulted in a T. kodakarensis strain that was no longer amenable to transformation, whereas the deletion of TK2289 (ΔhtkB) had no detrimental effects on transformation.


Genomic Context

Location: 1234730..1244933
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  TK_RS06995 (TK1409) - 1236272..1236454 (-) 183 WP_048053728.1 hypothetical protein -
  TK_RS07000 (TK1410) dnaG 1236523..1237917 (-) 1395 WP_011250361.1 DNA primase DnaG -
  TK_RS07005 (TK1411) - 1237914..1238315 (-) 402 WP_011250362.1 toprim domain-containing protein -
  TK_RS07010 (TK1412) - 1238372..1239646 (-) 1275 WP_011250363.1 TIGR04013 family B12-binding domain/radical SAM domain-containing protein -
  TK_RS07015 (TK1413) htkA 1239730..1239933 (-) 204 WP_011250364.1 archaeal histone HpkA Unclear
  TK_RS07020 (TK1414) dcd 1240272..1240739 (-) 468 WP_011250365.1 dCTP deaminase -
  TK_RS07030 (TK1415) rpl12p 1241531..1241851 (-) 321 WP_011250366.1 50S ribosomal protein P1 -
  TK_RS07035 (TK1416) - 1241922..1242944 (-) 1023 WP_011250367.1 50S ribosomal protein L10 -
  TK_RS07040 (TK1417) - 1242950..1243600 (-) 651 WP_011250368.1 50S ribosomal protein L1 -
  TK_RS07045 (TK1418) - 1243714..1244211 (-) 498 WP_011250369.1 50S ribosomal protein L11 -
  TK_RS07050 (TK1419) - 1244246..1244704 (-) 459 WP_011250370.1 transcription elongation factor Spt5 -
  TK_RS07055 (TK1420) - 1244727..1244912 (-) 186 WP_011250371.1 protein translocase SEC61 complex subunit gamma -

Sequence

Protein


Download         Length: 67 a.a.        Molecular weight: 7378.60 Da        Isoelectric Point: 8.5283

>NTDB_id=628 TK_RS07015 WP_011250364.1 1239730..1239933(-) (htkA) [Thermococcus kodakarensis KOD1]
MAELPIAPVDRLIRKAGAERVSEDAAKVLAEYLEEYAIELSKKAVDFARHAGRKTVKAEDIKLAIKA

Nucleotide


Download         Length: 204 bp        

>NTDB_id=628 TK_RS07015 WP_011250364.1 1239730..1239933(-) (htkA) [Thermococcus kodakarensis KOD1]
ATGGCCGAGCTTCCGATTGCCCCGGTTGACAGGCTTATAAGGAAGGCTGGCGCTGAGAGGGTCAGTGAGGATGCCGCCAA
GGTTCTCGCCGAGTACCTTGAGGAGTACGCCATCGAGCTCAGCAAGAAGGCCGTCGATTTCGCCAGGCACGCTGGCAGGA
AGACCGTCAAGGCTGAGGACATCAAGCTTGCCATCAAGGCCTGA

Domains

Predicted by InterproScan.

Histone-like transcription factor (CBF/NF-Y) and archaeal histone (CBFD_NFYB_HMF)

(2-65)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9Y8I1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Lubomira Čuboňováa et al. (2012) An archaeal histone is required for transformation of Thermococcus kodakarensis. Journal of Bacteriology 194(24):6864-74. [PMID: 23065975]