Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   BAPNAU_RS06715 Genome accession   NC_022530
Coordinates   1343482..1343748 (+) Length   88 a.a.
NCBI ID   WP_050496152.1    Uniprot ID   -
Organism   Bacillus velezensis NAU-B3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1338482..1348748
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAPNAU_RS06695 (BAPNAU_1275) - 1338751..1340052 (-) 1302 WP_022552961.1 hemolysin family protein -
  BAPNAU_RS06700 (BAPNAU_1276) - 1340198..1341148 (+) 951 WP_014418379.1 magnesium transporter CorA family protein -
  BAPNAU_RS06705 (BAPNAU_1277) comGA 1341341..1342411 (+) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  BAPNAU_RS06710 (BAPNAU_1278) comGB 1342398..1343435 (+) 1038 WP_022552962.1 competence type IV pilus assembly protein ComGB Machinery gene
  BAPNAU_RS06715 (BAPNAU_1279) comGC 1343482..1343748 (+) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  BAPNAU_RS06720 (BAPNAU_1280) comGD 1343738..1344175 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  BAPNAU_RS06725 (BAPNAU_1281) comGE 1344159..1344473 (+) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAPNAU_RS06730 (BAPNAU_1282) comGF 1344487..1344882 (+) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  BAPNAU_RS06735 (BAPNAU_1283) comGG 1344883..1345260 (+) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAPNAU_RS06740 (BAPNAU_1284) - 1345317..1345496 (+) 180 WP_022552966.1 YqzE family protein -
  BAPNAU_RS06745 (BAPNAU_1285) - 1345537..1345866 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BAPNAU_RS06750 (BAPNAU_1286) tapA 1346125..1346796 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  BAPNAU_RS06755 (BAPNAU_1287) - 1346768..1347352 (+) 585 WP_022552967.1 signal peptidase I -
  BAPNAU_RS06760 (BAPNAU_1288) - 1347417..1348202 (+) 786 WP_007408329.1 TasA family protein -
  BAPNAU_RS06765 (BAPNAU_1289) sinR 1348250..1348585 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9740.36 Da        Isoelectric Point: 6.4456

>NTDB_id=62652 BAPNAU_RS06715 WP_050496152.1 1343482..1343748(+) (comGC) [Bacillus velezensis NAU-B3]
MLIVLFIVSILLLITIPNVTKHNQSIQRKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=62652 BAPNAU_RS06715 WP_050496152.1 1343482..1343748(+) (comGC) [Bacillus velezensis NAU-B3]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCGTAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

73.611

81.818

0.602

Multiple sequence alignment