Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   LMD38_RS07990 Genome accession   NZ_CP086328
Coordinates   1510942..1511721 (+) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus pacificus strain anQ-h4     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1472052..1527161 1510942..1511721 within 0


Gene organization within MGE regions


Location: 1472052..1527161
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LMD38_RS07800 (LMD38_07800) rsmB 1472274..1473608 (+) 1335 WP_016718310.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  LMD38_RS07805 (LMD38_07805) rlmN 1473613..1474701 (+) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  LMD38_RS07810 (LMD38_07810) - 1474706..1475458 (+) 753 WP_000648696.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  LMD38_RS07815 (LMD38_07815) prkC 1475467..1477440 (+) 1974 WP_016718309.1 serine/threonine protein kinase PrkC -
  LMD38_RS07820 (LMD38_07820) rsgA 1477709..1478590 (+) 882 WP_001113936.1 ribosome small subunit-dependent GTPase A -
  LMD38_RS07825 (LMD38_07825) rpe 1478593..1479237 (+) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  LMD38_RS07830 (LMD38_07830) - 1479337..1480017 (+) 681 WP_062821669.1 thiamine diphosphokinase -
  LMD38_RS07835 (LMD38_07835) spoVM 1480084..1480164 (+) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  LMD38_RS07840 (LMD38_07840) rpmB 1480238..1480426 (-) 189 WP_000124776.1 50S ribosomal protein L28 -
  LMD38_RS07845 (LMD38_07845) - 1480805..1481167 (+) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  LMD38_RS07850 (LMD38_07850) - 1481190..1482866 (+) 1677 WP_000027110.1 DAK2 domain-containing protein -
  LMD38_RS07855 (LMD38_07855) recG 1483156..1485204 (+) 2049 WP_061183962.1 ATP-dependent DNA helicase RecG -
  LMD38_RS07860 (LMD38_07860) fapR 1485293..1485886 (+) 594 WP_000747357.1 transcription factor FapR -
  LMD38_RS07865 (LMD38_07865) plsX 1485883..1486875 (+) 993 WP_000684108.1 phosphate acyltransferase PlsX -
  LMD38_RS07870 (LMD38_07870) fabD 1486890..1487834 (+) 945 WP_061183964.1 ACP S-malonyltransferase -
  LMD38_RS07875 (LMD38_07875) fabG 1487834..1488574 (+) 741 WP_000911784.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  LMD38_RS07880 (LMD38_07880) acpP 1488644..1488877 (+) 234 WP_000786062.1 acyl carrier protein -
  LMD38_RS07885 (LMD38_07885) rncS 1488936..1489673 (+) 738 WP_001146876.1 ribonuclease III -
  LMD38_RS07890 (LMD38_07890) smc 1489821..1493390 (+) 3570 WP_228920245.1 chromosome segregation protein SMC -
  LMD38_RS07895 (LMD38_07895) ftsY 1493406..1494395 (+) 990 WP_000007647.1 signal recognition particle-docking protein FtsY -
  LMD38_RS07900 (LMD38_07900) - 1494529..1494861 (+) 333 WP_000891062.1 putative DNA-binding protein -
  LMD38_RS07905 (LMD38_07905) ffh 1494874..1496223 (+) 1350 WP_000863461.1 signal recognition particle protein -
  LMD38_RS07910 (LMD38_07910) rpsP 1496324..1496596 (+) 273 WP_000268750.1 30S ribosomal protein S16 -
  LMD38_RS07915 (LMD38_07915) - 1496611..1496838 (+) 228 WP_000737403.1 KH domain-containing protein -
  LMD38_RS07920 (LMD38_07920) rimM 1496960..1497475 (+) 516 WP_000170268.1 ribosome maturation factor RimM -
  LMD38_RS07925 (LMD38_07925) trmD 1497475..1498209 (+) 735 WP_016718304.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  LMD38_RS07930 (LMD38_07930) rplS 1498356..1498700 (+) 345 WP_001186516.1 50S ribosomal protein L19 -
  LMD38_RS07935 (LMD38_07935) lepB 1498802..1499353 (+) 552 WP_000711857.1 signal peptidase I -
  LMD38_RS07940 (LMD38_07940) ylqF 1499374..1500264 (+) 891 WP_000236698.1 ribosome biogenesis GTPase YlqF -
  LMD38_RS07945 (LMD38_07945) rnhB 1500316..1501089 (+) 774 WP_001174724.1 ribonuclease HII -
  LMD38_RS07950 (LMD38_07950) sucC 1501283..1502443 (+) 1161 WP_001020785.1 ADP-forming succinate--CoA ligase subunit beta -
  LMD38_RS07955 (LMD38_07955) sucD 1502463..1503365 (+) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  LMD38_RS07960 (LMD38_07960) dprA 1503453..1504322 (+) 870 WP_000818028.1 DNA-processing protein DprA -
  LMD38_RS07965 (LMD38_07965) topA 1504467..1506545 (+) 2079 WP_001286972.1 type I DNA topoisomerase -
  LMD38_RS07970 (LMD38_07970) trmFO 1506596..1507900 (+) 1305 WP_012644562.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  LMD38_RS07975 (LMD38_07975) xerC 1507966..1508865 (+) 900 WP_016718302.1 tyrosine recombinase XerC -
  LMD38_RS07980 (LMD38_07980) hslV 1508908..1509450 (+) 543 WP_000526271.1 ATP-dependent protease proteolytic subunit HslV -
  LMD38_RS07985 (LMD38_07985) hslU 1509473..1510864 (+) 1392 WP_000550081.1 ATP-dependent protease ATPase subunit HslU -
  LMD38_RS07990 (LMD38_07990) codY 1510942..1511721 (+) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  LMD38_RS07995 (LMD38_07995) rpsB 1512070..1512771 (+) 702 WP_000111483.1 30S ribosomal protein S2 -
  LMD38_RS08000 (LMD38_08000) tsf 1512875..1513762 (+) 888 WP_001018580.1 translation elongation factor Ts -
  LMD38_RS08005 (LMD38_08005) pyrH 1513829..1514551 (+) 723 WP_000042663.1 UMP kinase -
  LMD38_RS08010 (LMD38_08010) frr 1514554..1515111 (+) 558 WP_000531500.1 ribosome recycling factor -
  LMD38_RS08015 (LMD38_08015) uppS 1515197..1515973 (+) 777 WP_000971300.1 isoprenyl transferase -
  LMD38_RS08020 (LMD38_08020) cdsA 1515991..1516782 (+) 792 WP_000813584.1 phosphatidate cytidylyltransferase -
  LMD38_RS08025 (LMD38_08025) dxr 1516806..1517948 (+) 1143 WP_000790363.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  LMD38_RS08030 (LMD38_08030) rseP 1517965..1519221 (+) 1257 WP_001090246.1 RIP metalloprotease RseP -
  LMD38_RS08035 (LMD38_08035) - 1519331..1521031 (+) 1701 WP_000814305.1 proline--tRNA ligase -
  LMD38_RS08040 (LMD38_08040) - 1521156..1525457 (+) 4302 WP_062821668.1 PolC-type DNA polymerase III -
  LMD38_RS08045 (LMD38_08045) rimP 1525790..1526260 (+) 471 WP_000359097.1 ribosome maturation factor RimP -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=624305 LMD38_RS07990 WP_000421288.1 1510942..1511721(+) (codY) [Bacillus pacificus strain anQ-h4]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=624305 LMD38_RS07990 WP_000421288.1 1510942..1511721(+) (codY) [Bacillus pacificus strain anQ-h4]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAGCGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGCTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATTGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGTGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459