Detailed information NTG0615256

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: LIO32_RS00720
• Genome accession: NZ_CP085087
• Coordinates: 115422..115703 (+)
• Length: 93 a.a.
• NCBI ID: WP_011921720.1
• Uniprot ID: A0A0M9FL05
• Organism: Streptococcus suis strain Ssuis_MA2
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 110422..120703

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LIO32_RS00700	-	112092..112457 (+)	366	WP_002936568.1	DUF1033 family protein	-
LIO32_RS00705	-	112492..113435 (-)	944	Protein_106	S66 peptidase family protein	-
LIO32_RS00710	comYA	113521..114471 (+)	951	WP_011921718.1	competence type IV pilus ATPase ComGA	Machinery gene
LIO32_RS00715	comYB	114383..115420 (+)	1038	WP_256770774.1	competence type IV pilus assembly protein ComGB	Machinery gene
LIO32_RS00720	comYC	115422..115703 (+)	282	WP_011921720.1	competence type IV pilus major pilin ComGC	Machinery gene
LIO32_RS00725	comGD	115684..116091 (+)	408	WP_011921721.1	competence type IV pilus minor pilin ComGD	-
LIO32_RS00730	comYE	116063..116356 (+)	294	WP_011921722.1	competence type IV pilus minor pilin ComGE	Machinery gene
LIO32_RS00735	comGF/cglF	116343..116777 (+)	435	WP_011922561.1	competence type IV pilus minor pilin ComGF	Machinery gene
LIO32_RS00740	comGG	116755..117165 (+)	411	WP_011921724.1	competence type IV pilus minor pilin ComGG	-
LIO32_RS00745	comYH	117222..118175 (+)	954	WP_024406069.1	class I SAM-dependent methyltransferase	Machinery gene
LIO32_RS00750	-	118225..119412 (+)	1188	WP_012775473.1	acetate kinase	-
LIO32_RS00755	-	119726..120277 (+)	552	WP_012775474.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10408.34 Da
• Isoelectric Point: 7.0117

>NTDB_id=615256 LIO32_RS00720 WP_011921720.1 115422..115703(+) (comYC) [Streptococcus suis strain Ssuis_MA2]
MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQKKGDAAVVKVVESQMELYELEHDEEATVADLQAKGYI
TEKQAKQYATAKK

Nucleotide

• Length: 282 bp

>NTDB_id=615256 LIO32_RS00720 WP_011921720.1 115422..115703(+) (comYC) [Streptococcus suis strain Ssuis_MA2]
ATGAAAAAATTAGTTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTGGTCGTTTTAGGGATCATTAGCCTGCT
CTTGCTCCTCTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCTATTCAGAAGAAGGGGGATGCGGCTGTTGTCAAAGTAG
TGGAGAGTCAGATGGAGCTCTATGAATTGGAACATGACGAGGAAGCAACGGTGGCAGATTTGCAGGCGAAAGGTTATATT
ACTGAAAAACAAGCAAAACAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0M9FL05

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	100	100	1
comGC/cglC	Streptococcus mitis SK321	68.235	91.398	0.624
comGC/cglC	Streptococcus mitis NCTC 12261	68.235	91.398	0.624
comGC/cglC	Streptococcus pneumoniae D39	70.37	87.097	0.613
comGC/cglC	Streptococcus pneumoniae R6	70.37	87.097	0.613
comGC/cglC	Streptococcus pneumoniae TIGR4	70.37	87.097	0.613
comGC/cglC	Streptococcus pneumoniae Rx1	70.37	87.097	0.613
comYC	Streptococcus gordonii str. Challis substr. CH1	61.798	95.699	0.591
comYC	Streptococcus mutans UA140	60.227	94.624	0.57
comYC	Streptococcus mutans UA159	60.227	94.624	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	56.818	94.624	0.538
comGC	Staphylococcus aureus N315	50	83.871	0.419
comGC	Staphylococcus aureus MW2	50	83.871	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	49.333	80.645	0.398
comGC	Latilactobacillus sakei subsp. sakei 23K	43.75	86.022	0.376