Detailed information    

insolico Bioinformatically predicted

Overview

Name   comF   Type   Machinery gene
Locus tag   ABVS_RS05140 Genome accession   NZ_CP080576
Coordinates   1043977..1044411 (-) Length   144 a.a.
NCBI ID   WP_222112317.1    Uniprot ID   -
Organism   Acinetobacter lwoffii strain VS15     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 1035646..1060631 1043977..1044411 within 0


Gene organization within MGE regions


Location: 1035646..1060631
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABVS_RS05095 (ABVS_1068) tnpA 1036779..1037207 (+) 429 WP_222112314.1 IS66-like element accessory protein TnpA -
  ABVS_RS05100 (ABVS_1069) tnpB 1037204..1037539 (+) 336 WP_222112315.1 IS66 family insertion sequence element accessory protein TnpB -
  ABVS_RS05105 (ABVS_1070) tnpC 1037614..1038993 (+) 1380 Protein_985 IS66 family transposase -
  ABVS_RS05110 (ABVS_1071) ltrA 1039570..1041231 (+) 1662 WP_005167203.1 group II intron reverse transcriptase/maturase -
  ABVS_RS05115 (ABVS_1072) - 1041336..1041563 (+) 228 Protein_987 transposase domain-containing protein -
  ABVS_RS05120 (ABVS_1073) rplS 1041686..1042060 (-) 375 WP_005101283.1 50S ribosomal protein L19 -
  ABVS_RS05125 (ABVS_1074) trmD 1042246..1042980 (-) 735 WP_222112316.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  ABVS_RS05130 (ABVS_1075) rimM 1043008..1043556 (-) 549 WP_074383613.1 ribosome maturation factor RimM -
  ABVS_RS05135 (ABVS_1076) rpsP 1043575..1043832 (-) 258 WP_005094274.1 30S ribosomal protein S16 -
  ABVS_RS05140 (ABVS_1077) comF 1043977..1044411 (-) 435 WP_222112317.1 type IV pilin protein Machinery gene
  ABVS_RS05145 (ABVS_1078) - 1044411..1044959 (-) 549 WP_222112318.1 type IV pilin protein -
  ABVS_RS05150 (ABVS_1079) - 1044961..1048524 (-) 3564 WP_222112319.1 PilC/PilY family type IV pilus protein -
  ABVS_RS05155 (ABVS_1080) - 1048551..1049258 (-) 708 WP_420885073.1 pilus assembly protein PilX -
  ABVS_RS05160 (ABVS_1081) - 1049255..1050334 (-) 1080 WP_222112320.1 PilW family protein -
  ABVS_RS05165 (ABVS_1082) pilV 1050327..1050830 (-) 504 WP_222112321.1 type IV pilus modification protein PilV -
  ABVS_RS05170 (ABVS_1083) - 1050843..1051259 (-) 417 WP_222112322.1 pilus assembly FimT family protein -
  ABVS_RS05175 (ABVS_1084) ispH 1051421..1052371 (-) 951 WP_222112323.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
  ABVS_RS05180 (ABVS_1085) gmk 1052505..1053128 (+) 624 WP_004281187.1 guanylate kinase -
  ABVS_RS05185 (ABVS_1086) rpoZ 1053205..1053486 (+) 282 WP_004281186.1 DNA-directed RNA polymerase subunit omega -
  ABVS_RS05190 (ABVS_1087) - 1053701..1055806 (+) 2106 WP_222112324.1 RelA/SpoT family protein -
  ABVS_RS05195 (ABVS_1088) - 1055882..1056265 (+) 384 WP_005263848.1 RidA family protein -
  ABVS_RS05200 (ABVS_1089) - 1056608..1056802 (+) 195 WP_004732422.1 bacterioferritin-associated ferredoxin -
  ABVS_RS05205 (ABVS_1090) bfr 1057028..1057492 (+) 465 WP_004896252.1 heteropolymeric bacterioferritin subunit Bfr -
  ABVS_RS05210 (ABVS_1091) - 1057543..1059177 (-) 1635 WP_222112325.1 PglL family O-oligosaccharyltransferase -
  ABVS_RS05215 (ABVS_1092) tfpZ 1059275..1060009 (-) 735 WP_222112326.1 TfpX/TfpZ family type IV pilin accessory protein -
  ABVS_RS05220 (ABVS_1093) - 1060011..1060631 (-) 621 WP_222112327.1 hypothetical protein -

Sequence

Protein


Download         Length: 144 a.a.        Molecular weight: 16063.38 Da        Isoelectric Point: 8.4264

>NTDB_id=594181 ABVS_RS05140 WP_222112317.1 1043977..1044411(-) (comF) [Acinetobacter lwoffii strain VS15]
MHQIKGFTLIELMIAVAIIGILAAIAYPSYVEYVKRTNRTEMQTQLLTIMYKLQNYKVINHTYKNATLSALKVDSSYPST
GLYGVELLVDADGQGYLLKASPNTGKSQKNDGELCINQEGHRHWKKANMCDSSDLSATSNWDGK

Nucleotide


Download         Length: 435 bp        

>NTDB_id=594181 ABVS_RS05140 WP_222112317.1 1043977..1044411(-) (comF) [Acinetobacter lwoffii strain VS15]
ATGCATCAAATTAAAGGATTTACACTGATTGAATTAATGATTGCTGTCGCAATCATTGGGATTCTGGCTGCAATTGCATA
TCCTTCTTATGTTGAATATGTTAAACGCACAAATCGTACAGAGATGCAAACTCAATTGTTAACGATTATGTATAAGTTGC
AAAATTATAAAGTTATAAATCATACTTATAAGAATGCGACTTTATCTGCTTTGAAAGTTGATTCAAGCTATCCATCAACA
GGATTATATGGTGTTGAATTATTAGTCGATGCTGATGGGCAAGGGTATTTATTAAAAGCTTCACCTAATACAGGTAAAAG
TCAAAAAAATGATGGTGAATTGTGCATAAATCAAGAAGGTCATCGACACTGGAAAAAAGCTAATATGTGTGATAGCAGTG
ATCTAAGTGCCACCTCAAACTGGGATGGCAAATAA

Domains

Predicted by InterproScan.

Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS)

(28-115)

Prokaryotic N-terminal methylation motif (N_methyl)

(1-27)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comF Acinetobacter baylyi ADP1

51.064

97.917

0.5
  pilE Acinetobacter baumannii D1279779

40.714

97.222

0.396