Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   M3N36_RS00615 Genome accession   NZ_CP097251
Coordinates   101970..102254 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain 21SPY7071 isolate cerebral abscess     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 96970..107254
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M3N36_RS00590 (M3N36_00590) - 98915..99280 (+) 366 WP_002986560.1 DUF1033 family protein -
  M3N36_RS00595 (M3N36_00595) comGA 99374..100312 (+) 939 WP_030127399.1 competence type IV pilus ATPase ComGA Machinery gene
  M3N36_RS00600 (M3N36_00600) comGB 100248..101282 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  M3N36_RS00605 (M3N36_00605) comGC 101284..101610 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  M3N36_RS00610 (M3N36_00610) comGD 101585..102013 (+) 429 WP_030127397.1 competence type IV pilus minor pilin ComGD Machinery gene
  M3N36_RS00615 (M3N36_00615) comGE 101970..102254 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  M3N36_RS00620 (M3N36_00620) comGF 102247..102681 (+) 435 WP_002986542.1 competence type IV pilus minor pilin ComGF Machinery gene
  M3N36_RS00625 (M3N36_00625) comGG 102665..102991 (+) 327 WP_002986539.1 competence type IV pilus minor pilin ComGG -
  M3N36_RS00630 (M3N36_00630) comGH 103089..104042 (+) 954 WP_030127396.1 class I SAM-dependent methyltransferase Machinery gene
  M3N36_RS00635 (M3N36_00635) - 104101..105297 (+) 1197 WP_011888536.1 acetate kinase -
  M3N36_RS00640 (M3N36_00640) - 105484..105792 (+) 309 WP_030126458.1 hypothetical protein -
  M3N36_RS00645 (M3N36_00645) proC 105875..106645 (-) 771 WP_030127395.1 pyrroline-5-carboxylate reductase -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=594073 M3N36_RS00615 WP_002987779.1 101970..102254(+) (comGE) [Streptococcus pyogenes strain 21SPY7071 isolate cerebral abscess]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=594073 M3N36_RS00615 WP_002987779.1 101970..102254(+) (comGE) [Streptococcus pyogenes strain 21SPY7071 isolate cerebral abscess]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAT
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA

Domains

Predicted by InterProScan.

Type II secretory pathway pseudopilin (ComGE)

(12-93)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383