Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   MY487_RS11720 Genome accession   NZ_CP096033
Coordinates   2426820..2427134 (-) Length   104 a.a.
NCBI ID   WP_012117982.1    Uniprot ID   A7Z6N6
Organism   Bacillus amyloliquefaciens strain GL18     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2421820..2432134
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MY487_RS11675 (MY487_11675) sinI 2422502..2422675 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  MY487_RS11680 (MY487_11680) sinR 2422709..2423044 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MY487_RS11685 (MY487_11685) - 2423092..2423877 (-) 786 WP_007408329.1 TasA family protein -
  MY487_RS11690 (MY487_11690) - 2423942..2424526 (-) 585 WP_012117977.1 signal peptidase I -
  MY487_RS11695 (MY487_11695) tapA 2424498..2425169 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  MY487_RS11700 (MY487_11700) - 2425428..2425757 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  MY487_RS11705 (MY487_11705) - 2425797..2425976 (-) 180 WP_003153093.1 YqzE family protein -
  MY487_RS11710 (MY487_11710) comGG 2426033..2426410 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  MY487_RS11715 (MY487_11715) comGF 2426411..2426911 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  MY487_RS11720 (MY487_11720) comGE 2426820..2427134 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE Machinery gene
  MY487_RS11725 (MY487_11725) comGD 2427118..2427555 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  MY487_RS11730 (MY487_11730) comGC 2427545..2427853 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  MY487_RS11735 (MY487_11735) comGB 2427858..2428895 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  MY487_RS11740 (MY487_11740) comGA 2428882..2429952 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  MY487_RS11745 (MY487_11745) - 2430149..2431099 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11904.90 Da        Isoelectric Point: 6.9470

>NTDB_id=585808 MY487_RS11720 WP_012117982.1 2426820..2427134(-) (comGE) [Bacillus amyloliquefaciens strain GL18]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCTADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=585808 MY487_RS11720 WP_012117982.1 2426820..2427134(-) (comGE) [Bacillus amyloliquefaciens strain GL18]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTACGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6N6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

42.609

100

0.471