Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   KM387_RS19155 Genome accession   NZ_CP076201
Coordinates   3689689..3690468 (-) Length   259 a.a.
NCBI ID   WP_042514126.1    Uniprot ID   -
Organism   Bacillus anthracis strain A3783     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3655315..3729292 3689689..3690468 within 0


Gene organization within MGE regions


Location: 3655315..3729292
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KM387_RS19005 (KM387_18955) - 3655658..3657328 (-) 1671 WP_000823085.1 ribonuclease J -
  KM387_RS19010 (KM387_18960) dapA 3658099..3658977 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  KM387_RS19015 (KM387_18965) dapG 3658989..3660267 (-) 1279 Protein_3722 aspartate kinase -
  KM387_RS19020 (KM387_18970) asd 3660291..3661337 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  KM387_RS19025 (KM387_18975) dpaB 3661488..3662087 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  KM387_RS19030 (KM387_18980) dpaA 3662084..3662986 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  KM387_RS19035 (KM387_18985) - 3663261..3663512 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  KM387_RS19040 (KM387_18990) - 3663639..3664880 (-) 1242 WP_000592993.1 M16 family metallopeptidase -
  KM387_RS19045 (KM387_18995) - 3664967..3665866 (-) 900 WP_000647530.1 polysaccharide deacetylase family protein -
  KM387_RS19050 (KM387_19000) pnp 3666018..3668157 (-) 2140 Protein_3729 polyribonucleotide nucleotidyltransferase -
  KM387_RS19055 (KM387_19005) rpsO 3668318..3668587 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  KM387_RS19060 (KM387_19010) ribF 3668688..3669659 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  KM387_RS19065 (KM387_19015) truB 3669703..3670626 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  KM387_RS19070 (KM387_19020) rbfA 3670713..3671069 (-) 357 WP_000776441.1 30S ribosome-binding factor RbfA -
  KM387_RS19075 (KM387_19025) - 3671085..3671366 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  KM387_RS19080 (KM387_19030) infB 3671363..3673423 (-) 2061 WP_000036340.1 translation initiation factor IF-2 -
  KM387_RS19085 (KM387_19035) - 3673428..3673739 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  KM387_RS19090 (KM387_19040) rnpM 3673740..3674012 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  KM387_RS19095 (KM387_19045) nusA 3674024..3675130 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  KM387_RS19100 (KM387_19050) rimP 3675148..3675618 (-) 471 WP_000359093.1 ribosome maturation factor RimP -
  KM387_RS19105 (KM387_19055) - 3675951..3680252 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  KM387_RS19110 (KM387_19060) - 3680377..3682077 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  KM387_RS19115 (KM387_19065) rseP 3682187..3683443 (-) 1257 WP_001090228.1 RIP metalloprotease RseP -
  KM387_RS19120 (KM387_19070) dxr 3683460..3684602 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  KM387_RS19125 (KM387_19075) cdsA 3684626..3685417 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  KM387_RS19130 (KM387_19080) uppS 3685435..3686211 (-) 777 WP_000971301.1 isoprenyl transferase -
  KM387_RS19135 (KM387_19085) frr 3686297..3686854 (-) 558 WP_000531503.1 ribosome recycling factor -
  KM387_RS19140 (KM387_19090) pyrH 3686857..3687579 (-) 723 WP_000042663.1 UMP kinase -
  KM387_RS19145 (KM387_19095) tsf 3687646..3688533 (-) 888 WP_001018581.1 translation elongation factor Ts -
  KM387_RS19150 (KM387_19100) rpsB 3688637..3689338 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  KM387_RS19155 (KM387_19105) codY 3689689..3690468 (-) 780 WP_042514126.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  KM387_RS19160 (KM387_19110) hslU 3690546..3691937 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  KM387_RS19165 (KM387_19115) hslV 3691960..3692502 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  KM387_RS19170 (KM387_19120) xerC 3692545..3693444 (-) 900 WP_001101227.1 tyrosine recombinase XerC -
  KM387_RS19175 (KM387_19125) trmFO 3693510..3694814 (-) 1305 WP_009879846.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  KM387_RS19180 (KM387_19130) topA 3694865..3696943 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  KM387_RS19185 (KM387_19135) dprA 3697088..3697957 (-) 870 WP_000818036.1 DNA-processing protein DprA -
  KM387_RS19190 (KM387_19140) sucD 3698045..3698947 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  KM387_RS19195 (KM387_19145) sucC 3698968..3700128 (-) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  KM387_RS19200 (KM387_19150) rnhB 3700322..3701095 (-) 774 WP_001174712.1 ribonuclease HII -
  KM387_RS19205 (KM387_19155) ylqF 3701147..3702037 (-) 891 WP_000236696.1 ribosome biogenesis GTPase YlqF -
  KM387_RS19210 (KM387_19160) lepB 3702058..3702609 (-) 552 WP_000711857.1 signal peptidase I -
  KM387_RS19215 (KM387_19165) rplS 3702711..3703055 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  KM387_RS19220 (KM387_19170) trmD 3703202..3703936 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  KM387_RS19225 (KM387_19175) rimM 3703936..3704451 (-) 516 WP_000170268.1 ribosome maturation factor RimM -
  KM387_RS19230 (KM387_19180) - 3704572..3704799 (-) 228 WP_000737398.1 KH domain-containing protein -
  KM387_RS19235 (KM387_19185) rpsP 3704814..3705086 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  KM387_RS19240 (KM387_19190) ffh 3705187..3706536 (-) 1350 WP_000863456.1 signal recognition particle protein -
  KM387_RS19245 (KM387_19195) - 3706549..3706881 (-) 333 WP_000891062.1 putative DNA-binding protein -
  KM387_RS19250 (KM387_19200) ftsY 3707015..3708004 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  KM387_RS19255 (KM387_19205) smc 3708020..3711589 (-) 3570 WP_000478986.1 chromosome segregation protein SMC -
  KM387_RS19260 (KM387_19210) rncS 3711736..3712473 (-) 738 WP_001146873.1 ribonuclease III -
  KM387_RS19265 (KM387_19215) acpP 3712532..3712765 (-) 234 WP_000786062.1 acyl carrier protein -
  KM387_RS19270 (KM387_19220) fabG 3712835..3713575 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  KM387_RS19275 (KM387_19225) fabD 3713575..3714519 (-) 945 WP_000516948.1 ACP S-malonyltransferase -
  KM387_RS19280 (KM387_19230) plsX 3714534..3715526 (-) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  KM387_RS19285 (KM387_19235) fapR 3715523..3716116 (-) 594 WP_000747355.1 transcription factor FapR -
  KM387_RS19290 (KM387_19240) recG 3716205..3718253 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  KM387_RS19295 (KM387_19245) - 3718543..3720219 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  KM387_RS19300 (KM387_19250) - 3720242..3720604 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  KM387_RS19305 (KM387_19255) rpmB 3720983..3721171 (+) 189 WP_000124778.1 50S ribosomal protein L28 -
  KM387_RS19310 (KM387_19260) spoVM 3721244..3721324 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  KM387_RS19315 (KM387_19265) - 3721391..3722071 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  KM387_RS19320 (KM387_19270) rpe 3722171..3722815 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  KM387_RS19325 (KM387_19275) rsgA 3722818..3723699 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  KM387_RS19330 (KM387_19280) prkC 3723968..3725941 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  KM387_RS19335 (KM387_19285) - 3725950..3726702 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  KM387_RS19340 (KM387_19290) rlmN 3726707..3727795 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  KM387_RS19345 (KM387_19295) rsmB 3727800..3729134 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28721.00 Da        Isoelectric Point: 4.7153

>NTDB_id=573432 KM387_RS19155 WP_042514126.1 3689689..3690468(-) (codY) [Bacillus anthracis strain A3783]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESCSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=573432 KM387_RS19155 WP_042514126.1 3689689..3690468(-) (codY) [Bacillus anthracis strain A3783]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGTGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY helix-turn-helix domain (HTH_CodY)

(198-255)

CodY GAF-like domain (CodY)

(2-178)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

80.695

100

0.807
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.275

98.456

0.456