Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   KM393_RS18740 Genome accession   NZ_CP076190
Coordinates   3613016..3613795 (-) Length   259 a.a.
NCBI ID   WP_033649276.1    Uniprot ID   -
Organism   Bacillus anthracis strain Pasteur     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3578694..3652618 3613016..3613795 within 0


Gene organization within MGE regions


Location: 3578694..3652618
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KM393_RS18590 (KM393_18615) - 3579038..3580708 (-) 1671 WP_000823085.1 ribonuclease J -
  KM393_RS18595 (KM393_18620) dapA 3581474..3582352 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  KM393_RS18600 (KM393_18625) dapG 3582364..3583596 (-) 1233 WP_000692470.1 aspartate kinase -
  KM393_RS18605 (KM393_18630) asd 3583620..3584666 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  KM393_RS18610 (KM393_18635) dpaB 3584817..3585416 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  KM393_RS18615 (KM393_18640) dpaA 3585413..3586315 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  KM393_RS18620 (KM393_18645) - 3586590..3586841 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  KM393_RS18625 (KM393_18650) - 3586968..3588209 (-) 1242 WP_000592993.1 pitrilysin family protein -
  KM393_RS18630 (KM393_18655) - 3588296..3589195 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  KM393_RS18635 (KM393_18660) pnp 3589347..3591485 (-) 2139 WP_000076750.1 polyribonucleotide nucleotidyltransferase -
  KM393_RS18640 (KM393_18665) rpsO 3591646..3591915 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  KM393_RS18645 (KM393_18670) ribF 3592016..3592987 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  KM393_RS18650 (KM393_18675) truB 3593031..3593954 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  KM393_RS18655 (KM393_18680) rbfA 3594041..3594397 (-) 357 WP_000776446.1 30S ribosome-binding factor RbfA -
  KM393_RS18660 (KM393_18685) - 3594413..3594694 (-) 282 WP_000582364.1 DUF503 family protein -
  KM393_RS18665 (KM393_18690) infB 3594691..3596751 (-) 2061 WP_000036339.1 translation initiation factor IF-2 -
  KM393_RS18670 (KM393_18695) - 3596756..3597067 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  KM393_RS18675 (KM393_18700) - 3597068..3597340 (-) 273 WP_000071128.1 YlxR family protein -
  KM393_RS18680 (KM393_18705) nusA 3597352..3598458 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  KM393_RS18685 (KM393_18710) rimP 3598476..3598946 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  KM393_RS18690 (KM393_18715) - 3599279..3603580 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  KM393_RS18695 (KM393_18720) - 3603705..3605405 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  KM393_RS18700 (KM393_18725) rseP 3605515..3606771 (-) 1257 WP_001090228.1 RIP metalloprotease RseP -
  KM393_RS18705 (KM393_18730) dxr 3606788..3607930 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  KM393_RS18710 (KM393_18735) cdsA 3607954..3608745 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  KM393_RS18715 (KM393_18740) uppS 3608763..3609539 (-) 777 WP_000971303.1 isoprenyl transferase -
  KM393_RS18720 (KM393_18745) frr 3609625..3610182 (-) 558 WP_000531503.1 ribosome recycling factor -
  KM393_RS18725 (KM393_18750) pyrH 3610185..3610907 (-) 723 WP_000042663.1 UMP kinase -
  KM393_RS18730 (KM393_18755) tsf 3610974..3611861 (-) 888 WP_001018581.1 translation elongation factor Ts -
  KM393_RS18735 (KM393_18760) rpsB 3611965..3612666 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  KM393_RS18740 (KM393_18765) codY 3613016..3613795 (-) 780 WP_033649276.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  KM393_RS18745 (KM393_18770) hslU 3613873..3615264 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  KM393_RS18750 (KM393_18775) hslV 3615287..3615829 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  KM393_RS18755 (KM393_18780) xerC 3615872..3616771 (-) 900 WP_001101226.1 tyrosine recombinase XerC -
  KM393_RS18760 (KM393_18785) trmFO 3616837..3618141 (-) 1305 WP_003161605.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  KM393_RS18765 (KM393_18790) topA 3618192..3620270 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  KM393_RS18770 (KM393_18795) dprA 3620415..3621283 (-) 869 Protein_3664 DNA-processing protein DprA -
  KM393_RS18775 (KM393_18800) sucD 3621371..3622273 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  KM393_RS18780 (KM393_18805) sucC 3622294..3623454 (-) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  KM393_RS18785 (KM393_18810) rnhB 3623648..3624421 (-) 774 WP_017651024.1 ribonuclease HII -
  KM393_RS18790 (KM393_18815) ylqF 3624473..3625363 (-) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  KM393_RS18795 (KM393_18820) lepB 3625384..3625935 (-) 552 WP_000711857.1 signal peptidase I -
  KM393_RS18800 (KM393_18825) rplS 3626037..3626381 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  KM393_RS18805 (KM393_18830) trmD 3626528..3627262 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  KM393_RS18810 (KM393_18835) rimM 3627262..3627777 (-) 516 WP_000170269.1 ribosome maturation factor RimM -
  KM393_RS18815 (KM393_18840) - 3627898..3628125 (-) 228 WP_000737398.1 KH domain-containing protein -
  KM393_RS18820 (KM393_18845) rpsP 3628140..3628412 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  KM393_RS18825 (KM393_18850) ffh 3628513..3629862 (-) 1350 WP_000863456.1 signal recognition particle protein -
  KM393_RS18830 (KM393_18855) - 3629875..3630207 (-) 333 WP_000891062.1 putative DNA-binding protein -
  KM393_RS18835 (KM393_18860) ftsY 3630341..3631330 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  KM393_RS18840 (KM393_18865) smc 3631346..3634915 (-) 3570 WP_000478985.1 chromosome segregation protein SMC -
  KM393_RS18845 (KM393_18870) rncS 3635062..3635799 (-) 738 WP_017651025.1 ribonuclease III -
  KM393_RS18850 (KM393_18875) acpP 3635858..3636091 (-) 234 WP_000786062.1 acyl carrier protein -
  KM393_RS18855 (KM393_18880) fabG 3636161..3636901 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  KM393_RS18860 (KM393_18885) fabD 3636901..3637845 (-) 945 WP_000516958.1 ACP S-malonyltransferase -
  KM393_RS18865 (KM393_18890) plsX 3637860..3638852 (-) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  KM393_RS18870 (KM393_18895) fapR 3638849..3639442 (-) 594 WP_000747352.1 transcription factor FapR -
  KM393_RS18875 (KM393_18900) recG 3639531..3641579 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  KM393_RS18880 (KM393_18905) - 3641869..3643545 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  KM393_RS18885 (KM393_18910) - 3643568..3643930 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  KM393_RS18890 (KM393_18915) rpmB 3644309..3644497 (+) 189 WP_000124778.1 50S ribosomal protein L28 -
  KM393_RS18895 (KM393_18920) spoVM 3644570..3644650 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  KM393_RS18900 (KM393_18925) - 3644717..3645397 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  KM393_RS18905 (KM393_18930) rpe 3645497..3646141 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  KM393_RS18910 (KM393_18935) rsgA 3646144..3647025 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  KM393_RS18915 (KM393_18940) prkC 3647294..3649267 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  KM393_RS18920 (KM393_18945) - 3649276..3650028 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  KM393_RS18925 (KM393_18950) rlmN 3650033..3651121 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  KM393_RS18930 (KM393_18955) rsmB 3651126..3652460 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28760.02 Da        Isoelectric Point: 4.7947

>NTDB_id=573245 KM393_RS18740 WP_033649276.1 3613016..3613795(-) (codY) [Bacillus anthracis strain Pasteur]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGVLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=573245 KM393_RS18740 WP_033649276.1 3613016..3613795(-) (codY) [Bacillus anthracis strain Pasteur]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTGTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

80.695

100

0.807

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459