Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   JNO61_RS18795 Genome accession   NZ_CP076184
Coordinates   3618166..3618945 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus anthracis strain A49     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3583844..3657768 3618166..3618945 within 0


Gene organization within MGE regions


Location: 3583844..3657768
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JNO61_RS18645 (JNO61_18645) - 3584188..3585858 (-) 1671 WP_000823085.1 ribonuclease J -
  JNO61_RS18650 (JNO61_18650) dapA 3586624..3587502 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  JNO61_RS18655 (JNO61_18655) dapG 3587514..3588746 (-) 1233 WP_000692470.1 aspartate kinase -
  JNO61_RS18660 (JNO61_18660) asd 3588770..3589816 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  JNO61_RS18665 (JNO61_18665) dpaB 3589967..3590566 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  JNO61_RS18670 (JNO61_18670) dpaA 3590563..3591465 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  JNO61_RS18675 (JNO61_18675) - 3591740..3591991 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  JNO61_RS18680 (JNO61_18680) - 3592118..3593359 (-) 1242 WP_000592993.1 M16 family metallopeptidase -
  JNO61_RS18685 (JNO61_18685) - 3593446..3594345 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  JNO61_RS18690 (JNO61_18690) pnp 3594497..3596635 (-) 2139 WP_000076750.1 polyribonucleotide nucleotidyltransferase -
  JNO61_RS18695 (JNO61_18695) rpsO 3596796..3597065 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  JNO61_RS18700 (JNO61_18700) ribF 3597166..3598137 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  JNO61_RS18705 (JNO61_18705) truB 3598181..3599104 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  JNO61_RS18710 (JNO61_18710) rbfA 3599191..3599547 (-) 357 WP_000776446.1 30S ribosome-binding factor RbfA -
  JNO61_RS18715 (JNO61_18715) - 3599563..3599844 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  JNO61_RS18720 (JNO61_18720) infB 3599841..3601901 (-) 2061 WP_000036339.1 translation initiation factor IF-2 -
  JNO61_RS18725 (JNO61_18725) - 3601906..3602217 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  JNO61_RS18730 (JNO61_18730) rnpM 3602218..3602490 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  JNO61_RS18735 (JNO61_18735) nusA 3602502..3603608 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  JNO61_RS18740 (JNO61_18740) rimP 3603626..3604096 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  JNO61_RS18745 (JNO61_18745) - 3604429..3608730 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  JNO61_RS18750 (JNO61_18750) - 3608855..3610555 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  JNO61_RS18755 (JNO61_18755) rseP 3610665..3611921 (-) 1257 WP_001090228.1 RIP metalloprotease RseP -
  JNO61_RS18760 (JNO61_18760) dxr 3611938..3613080 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  JNO61_RS18765 (JNO61_18765) cdsA 3613104..3613895 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  JNO61_RS18770 (JNO61_18770) uppS 3613913..3614689 (-) 777 WP_000971303.1 isoprenyl transferase -
  JNO61_RS18775 (JNO61_18775) frr 3614775..3615332 (-) 558 WP_000531503.1 ribosome recycling factor -
  JNO61_RS18780 (JNO61_18780) pyrH 3615335..3616057 (-) 723 WP_000042663.1 UMP kinase -
  JNO61_RS18785 (JNO61_18785) tsf 3616124..3617011 (-) 888 WP_001018581.1 translation elongation factor Ts -
  JNO61_RS18790 (JNO61_18790) rpsB 3617115..3617816 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  JNO61_RS18795 (JNO61_18795) codY 3618166..3618945 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  JNO61_RS18800 (JNO61_18800) hslU 3619023..3620414 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  JNO61_RS18805 (JNO61_18805) hslV 3620437..3620979 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  JNO61_RS18810 (JNO61_18810) xerC 3621022..3621921 (-) 900 WP_001101226.1 tyrosine recombinase XerC -
  JNO61_RS18815 (JNO61_18815) trmFO 3621987..3623291 (-) 1305 WP_003161605.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  JNO61_RS18820 (JNO61_18820) topA 3623342..3625420 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  JNO61_RS18825 (JNO61_18825) dprA 3625565..3626313 (-) 749 Protein_3683 DNA-processing protein DprA -
  JNO61_RS18830 (JNO61_18830) sucD 3626521..3627423 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  JNO61_RS18835 (JNO61_18835) sucC 3627444..3628604 (-) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  JNO61_RS18840 (JNO61_18840) rnhB 3628798..3629571 (-) 774 WP_017651024.1 ribonuclease HII -
  JNO61_RS18845 (JNO61_18845) ylqF 3629623..3630513 (-) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  JNO61_RS18850 (JNO61_18850) lepB 3630534..3631085 (-) 552 WP_000711857.1 signal peptidase I -
  JNO61_RS18855 (JNO61_18855) rplS 3631187..3631531 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  JNO61_RS18860 (JNO61_18860) trmD 3631678..3632412 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  JNO61_RS18865 (JNO61_18865) rimM 3632412..3632927 (-) 516 WP_000170269.1 ribosome maturation factor RimM -
  JNO61_RS18870 (JNO61_18870) - 3633048..3633275 (-) 228 WP_000737398.1 KH domain-containing protein -
  JNO61_RS18875 (JNO61_18875) rpsP 3633290..3633562 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  JNO61_RS18880 (JNO61_18880) ffh 3633663..3635012 (-) 1350 WP_000863456.1 signal recognition particle protein -
  JNO61_RS18885 (JNO61_18885) - 3635025..3635357 (-) 333 WP_000891062.1 putative DNA-binding protein -
  JNO61_RS18890 (JNO61_18890) ftsY 3635491..3636480 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  JNO61_RS18895 (JNO61_18895) smc 3636496..3640065 (-) 3570 WP_000478985.1 chromosome segregation protein SMC -
  JNO61_RS18900 (JNO61_18900) rncS 3640212..3640949 (-) 738 WP_017651025.1 ribonuclease III -
  JNO61_RS18905 (JNO61_18905) acpP 3641008..3641241 (-) 234 WP_000786062.1 acyl carrier protein -
  JNO61_RS18910 (JNO61_18910) fabG 3641311..3642051 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  JNO61_RS18915 (JNO61_18915) fabD 3642051..3642995 (-) 945 WP_000516958.1 ACP S-malonyltransferase -
  JNO61_RS18920 (JNO61_18920) plsX 3643010..3644002 (-) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  JNO61_RS18925 (JNO61_18925) fapR 3643999..3644592 (-) 594 WP_000747352.1 transcription factor FapR -
  JNO61_RS18930 (JNO61_18930) recG 3644681..3646729 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  JNO61_RS18935 (JNO61_18935) - 3647019..3648695 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  JNO61_RS18940 (JNO61_18940) - 3648718..3649080 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  JNO61_RS18945 (JNO61_18945) rpmB 3649459..3649647 (+) 189 WP_000124778.1 50S ribosomal protein L28 -
  JNO61_RS18950 (JNO61_18950) spoVM 3649720..3649800 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  JNO61_RS18955 (JNO61_18955) - 3649867..3650547 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  JNO61_RS18960 (JNO61_18960) rpe 3650647..3651291 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  JNO61_RS18965 (JNO61_18965) rsgA 3651294..3652175 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  JNO61_RS18970 (JNO61_18970) prkC 3652444..3654417 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  JNO61_RS18975 (JNO61_18975) - 3654426..3655178 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  JNO61_RS18980 (JNO61_18980) rlmN 3655183..3656271 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  JNO61_RS18985 (JNO61_18985) rsmB 3656276..3657610 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=573152 JNO61_RS18795 WP_000421288.1 3618166..3618945(-) (codY) [Bacillus anthracis strain A49]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=573152 JNO61_RS18795 WP_000421288.1 3618166..3618945(-) (codY) [Bacillus anthracis strain A49]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459