Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   KM412_RS18885 Genome accession   NZ_CP076160
Coordinates   3644248..3645027 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus anthracis strain 4-IZSLT     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3609926..3683850 3644248..3645027 within 0


Gene organization within MGE regions


Location: 3609926..3683850
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KM412_RS18735 (KM412_18750) - 3610270..3611940 (-) 1671 WP_000823085.1 ribonuclease J -
  KM412_RS18740 (KM412_18755) dapA 3612706..3613584 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  KM412_RS18745 (KM412_18760) dapG 3613596..3614828 (-) 1233 Protein_3665 aspartate kinase -
  KM412_RS18750 (KM412_18765) asd 3614852..3615898 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  KM412_RS18755 (KM412_18770) dpaB 3616049..3616648 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  KM412_RS18760 (KM412_18775) dpaA 3616645..3617547 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  KM412_RS18765 (KM412_18780) - 3617822..3618073 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  KM412_RS18770 (KM412_18785) - 3618200..3619441 (-) 1242 WP_000592993.1 M16 family metallopeptidase -
  KM412_RS18775 (KM412_18790) - 3619528..3620427 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  KM412_RS18780 (KM412_18795) pnp 3620579..3622717 (-) 2139 WP_000076750.1 polyribonucleotide nucleotidyltransferase -
  KM412_RS18785 (KM412_18800) rpsO 3622878..3623147 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  KM412_RS18790 (KM412_18805) ribF 3623248..3624219 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  KM412_RS18795 (KM412_18810) truB 3624263..3625186 (-) 924 WP_000399357.1 tRNA pseudouridine(55) synthase TruB -
  KM412_RS18800 (KM412_18815) rbfA 3625273..3625629 (-) 357 WP_000776446.1 30S ribosome-binding factor RbfA -
  KM412_RS18805 (KM412_18820) - 3625645..3625926 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  KM412_RS18810 (KM412_18825) infB 3625923..3627983 (-) 2061 WP_000036339.1 translation initiation factor IF-2 -
  KM412_RS18815 (KM412_18830) - 3627988..3628299 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  KM412_RS18820 (KM412_18835) rnpM 3628300..3628572 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  KM412_RS18825 (KM412_18840) nusA 3628584..3629690 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  KM412_RS18830 (KM412_18845) rimP 3629708..3630178 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  KM412_RS18835 (KM412_18850) - 3630511..3634812 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  KM412_RS18840 (KM412_18855) - 3634937..3636637 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  KM412_RS18845 (KM412_18860) rseP 3636747..3638003 (-) 1257 WP_001090228.1 RIP metalloprotease RseP -
  KM412_RS18850 (KM412_18865) dxr 3638020..3639162 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  KM412_RS18855 (KM412_18870) cdsA 3639186..3639977 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  KM412_RS18860 (KM412_18875) uppS 3639995..3640771 (-) 777 WP_000971303.1 isoprenyl transferase -
  KM412_RS18865 (KM412_18880) frr 3640857..3641414 (-) 558 WP_000531503.1 ribosome recycling factor -
  KM412_RS18870 (KM412_18885) pyrH 3641417..3642139 (-) 723 WP_000042663.1 UMP kinase -
  KM412_RS18875 (KM412_18890) tsf 3642206..3643093 (-) 888 WP_001018581.1 translation elongation factor Ts -
  KM412_RS18880 (KM412_18895) rpsB 3643197..3643898 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  KM412_RS18885 (KM412_18900) codY 3644248..3645027 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  KM412_RS18890 (KM412_18905) hslU 3645105..3646496 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  KM412_RS18895 (KM412_18910) hslV 3646519..3647061 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  KM412_RS18900 (KM412_18915) xerC 3647104..3648003 (-) 900 WP_001101226.1 tyrosine recombinase XerC -
  KM412_RS18905 (KM412_18920) trmFO 3648069..3649373 (-) 1305 WP_003161605.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  KM412_RS18910 (KM412_18925) topA 3649424..3651502 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  KM412_RS18915 (KM412_18930) dprA 3651647..3652395 (-) 749 Protein_3699 DNA-processing protein DprA -
  KM412_RS18920 (KM412_18935) sucD 3652603..3653505 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  KM412_RS18925 (KM412_18940) sucC 3653526..3654686 (-) 1161 WP_001020786.1 ADP-forming succinate--CoA ligase subunit beta -
  KM412_RS18930 (KM412_18945) rnhB 3654880..3655653 (-) 774 WP_001174712.1 ribonuclease HII -
  KM412_RS18935 (KM412_18950) ylqF 3655705..3656595 (-) 891 WP_000236707.1 ribosome biogenesis GTPase YlqF -
  KM412_RS18940 (KM412_18955) lepB 3656616..3657167 (-) 552 WP_000711857.1 signal peptidase I -
  KM412_RS18945 (KM412_18960) rplS 3657269..3657613 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  KM412_RS18950 (KM412_18965) trmD 3657760..3658494 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  KM412_RS18955 (KM412_18970) rimM 3658494..3659009 (-) 516 WP_000170269.1 ribosome maturation factor RimM -
  KM412_RS18960 (KM412_18975) - 3659130..3659357 (-) 228 WP_000737398.1 KH domain-containing protein -
  KM412_RS18965 (KM412_18980) rpsP 3659372..3659644 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  KM412_RS18970 (KM412_18985) ffh 3659745..3661094 (-) 1350 WP_000863456.1 signal recognition particle protein -
  KM412_RS18975 (KM412_18990) - 3661107..3661439 (-) 333 WP_000891062.1 putative DNA-binding protein -
  KM412_RS18980 (KM412_18995) ftsY 3661573..3662562 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  KM412_RS18985 (KM412_19000) smc 3662578..3666147 (-) 3570 WP_000478985.1 chromosome segregation protein SMC -
  KM412_RS18990 (KM412_19005) rncS 3666294..3667031 (-) 738 WP_001146873.1 ribonuclease III -
  KM412_RS18995 (KM412_19010) acpP 3667090..3667323 (-) 234 WP_000786062.1 acyl carrier protein -
  KM412_RS19000 (KM412_19015) fabG 3667393..3668133 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  KM412_RS19005 (KM412_19020) fabD 3668133..3669077 (-) 945 WP_000516958.1 ACP S-malonyltransferase -
  KM412_RS19010 (KM412_19025) plsX 3669092..3670084 (-) 993 WP_000684111.1 phosphate acyltransferase PlsX -
  KM412_RS19015 (KM412_19030) fapR 3670081..3670674 (-) 594 WP_000747352.1 transcription factor FapR -
  KM412_RS19020 (KM412_19035) recG 3670763..3672811 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  KM412_RS19025 (KM412_19040) - 3673101..3674777 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  KM412_RS19030 (KM412_19045) - 3674800..3675162 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  KM412_RS19035 (KM412_19050) rpmB 3675541..3675729 (+) 189 WP_000124778.1 50S ribosomal protein L28 -
  KM412_RS19040 (KM412_19055) spoVM 3675802..3675882 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  KM412_RS19045 (KM412_19060) - 3675949..3676629 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  KM412_RS19050 (KM412_19065) rpe 3676729..3677373 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  KM412_RS19055 (KM412_19070) rsgA 3677376..3678257 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  KM412_RS19060 (KM412_19075) prkC 3678526..3680499 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  KM412_RS19065 (KM412_19080) - 3680508..3681260 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  KM412_RS19070 (KM412_19085) rlmN 3681265..3682353 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  KM412_RS19075 (KM412_19090) rsmB 3682358..3683692 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=572729 KM412_RS18885 WP_000421288.1 3644248..3645027(-) (codY) [Bacillus anthracis strain 4-IZSLT]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=572729 KM412_RS18885 WP_000421288.1 3644248..3645027(-) (codY) [Bacillus anthracis strain 4-IZSLT]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459