Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   MNY35_RS19325 Genome accession   NZ_CP093298
Coordinates   3951648..3951962 (+) Length   104 a.a.
NCBI ID   WP_012117982.1    Uniprot ID   A7Z6N6
Organism   Bacillus amyloliquefaciens strain MN-13     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3946648..3956962
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MNY35_RS19300 (MNY35_19265) - 3947687..3948637 (+) 951 WP_015417820.1 magnesium transporter CorA family protein -
  MNY35_RS19305 (MNY35_19270) comGA 3948830..3949900 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  MNY35_RS19310 (MNY35_19275) comGB 3949887..3950924 (+) 1038 WP_158185901.1 competence type IV pilus assembly protein ComGB Machinery gene
  MNY35_RS19315 (MNY35_19280) comGC 3950929..3951237 (+) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  MNY35_RS19320 (MNY35_19285) comGD 3951227..3951664 (+) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  MNY35_RS19325 (MNY35_19290) comGE 3951648..3951962 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE Machinery gene
  MNY35_RS19330 (MNY35_19295) comGF 3951871..3952371 (+) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  MNY35_RS19335 (MNY35_19300) comGG 3952372..3952749 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  MNY35_RS19340 (MNY35_19305) - 3952806..3952985 (+) 180 WP_003153093.1 YqzE family protein -
  MNY35_RS19345 (MNY35_19310) - 3953025..3953354 (-) 330 WP_039254490.1 DUF3889 domain-containing protein -
  MNY35_RS19350 (MNY35_19315) tapA 3953613..3954284 (+) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  MNY35_RS19355 (MNY35_19320) - 3954256..3954840 (+) 585 WP_015240205.1 signal peptidase I -
  MNY35_RS19360 (MNY35_19325) - 3954905..3955690 (+) 786 WP_007408329.1 TasA family protein -
  MNY35_RS19365 (MNY35_19330) sinR 3955738..3956073 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MNY35_RS19370 (MNY35_19335) sinI 3956107..3956280 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11904.90 Da        Isoelectric Point: 6.9470

>NTDB_id=571272 MNY35_RS19325 WP_012117982.1 3951648..3951962(+) (comGE) [Bacillus amyloliquefaciens strain MN-13]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCTADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=571272 MNY35_RS19325 WP_012117982.1 3951648..3951962(+) (comGE) [Bacillus amyloliquefaciens strain MN-13]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTACGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6N6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

42.609

100

0.471