Detailed information    

insolico Bioinformatically predicted

Overview


Name   comS   Type   Regulator
Locus tag   - Genome accession   NC_012004
Coordinates   63049..63144 (+) Length   32 a.a.
NCBI ID   - Uniprot ID   -
Organism   Streptococcus uberis 0140J     
Function   activate transcription of comX; activate transcription of comS (predicted from homology)   
Competence regulation

Genomic Context


Location: 58049..68144
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SUB_RS00350 (SUB0054) purE 58762..59250 (+) 489 WP_012657620.1 5-(carboxyamino)imidazole ribonucleotide mutase -
  SUB_RS00355 (SUB0055) purK 59237..60310 (+) 1074 WP_012657621.1 5-(carboxyamino)imidazole ribonucleotide synthase -
  SUB_RS00360 (SUB0056) purB 60624..61916 (+) 1293 WP_012657622.1 adenylosuccinate lyase -
  SUB_RS00365 (SUB0057) - 62035..62949 (+) 915 WP_269441089.1 helix-turn-helix domain-containing protein -
  SUB_RS09690 comS 63049..63144 (+) 96 WP_198433762.1 quorum-sensing system DWW-type pheromone Regulator
  SUB_RS00370 (SUB0059) ruvB 63179..64183 (+) 1005 WP_012657625.1 Holliday junction branch migration DNA helicase RuvB -
  SUB_RS00375 (SUB0060) - 64434..64862 (+) 429 WP_012657626.1 low molecular weight protein-tyrosine-phosphatase -
  SUB_RS00380 (SUB0061) - 64867..65280 (+) 414 WP_012657627.1 membrane protein -
  SUB_RS00385 (SUB0062) - 65277..67055 (+) 1779 WP_012657628.1 acyltransferase family protein -

Sequence


Protein


Download         Length: 32 a.a.        Molecular weight: 3877.60 Da        Isoelectric Point: 8.7337

>NTDB_id=570 63049..63144(+) (comS) [Streptococcus uberis 0140J]
MFKKIHFYVTTFSFLAVALITFLSEKDWWHIG

Nucleotide


Download         Length: 96 bp        

>NTDB_id=570 63049..63144(+) (comS) [Streptococcus uberis 0140J]
ATGTTTAAAAAAATTCATTTTTATGTAACTACTTTTTCTTTTCTAGCTGTTGCACTGATTACTTTTCTATCTGAAAAAGA
TTGGTGGCATATCGGA

XIP


This gene is known to encode the precursor of σX inducing peptide (XIP), which involves in competence development. The mature XIP sequence is displayed as below:

KDWWHIG


Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value