Detailed information    

insolico Bioinformatically predicted

Overview

Name   comS   Type   Regulator
Locus tag   - Genome accession   NZ_ALWR01000004
Coordinates   25330..25425 (-) Length   32 a.a.
NCBI ID   - Uniprot ID   -
Organism   Streptococcus parauberis KRS-02109     
Function   activate transcription of comX; activate transcription of comS (predicted from homology)   
Competence regulation

Genomic Context

Location: 20330..30425
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPJ2_RS07295 (SPJ2_1490) - 21337..23115 (-) 1779 WP_003107454.1 acyltransferase family protein -
  SPJ2_RS07300 (SPJ2_1491) - 23112..23513 (-) 402 WP_003105881.1 membrane protein -
  SPJ2_RS07305 (SPJ2_1492) - 23542..23970 (-) 429 WP_003107455.1 low molecular weight protein-tyrosine-phosphatase -
  SPJ2_RS07310 (SPJ2_1493) ruvB 24194..25192 (-) 999 WP_003107456.1 Holliday junction branch migration DNA helicase RuvB -
  SPJ2_RS10725 comS 25330..25425 (-) 96 WP_199764314.1 quorum-sensing system DWW-type pheromone Regulator
  SPJ2_RS07315 (SPJ2_1494) - 25491..26408 (-) 918 WP_003107457.1 helix-turn-helix transcriptional regulator -
  SPJ2_RS07320 (SPJ2_1495) purB 26525..27817 (-) 1293 WP_003107459.1 adenylosuccinate lyase -
  SPJ2_RS07325 (SPJ2_1496) purK 27827..28912 (-) 1086 WP_003107461.1 5-(carboxyamino)imidazole ribonucleotide synthase -
  SPJ2_RS07330 (SPJ2_1497) purE 28899..29387 (-) 489 WP_003107462.1 5-(carboxyamino)imidazole ribonucleotide mutase -

Sequence

Protein


Download         Length: 32 a.a.        Molecular weight: 3892.77 Da        Isoelectric Point: 10.2299

>NTDB_id=569 25330..25425(-) (comS) [Streptococcus parauberis KRS-02109]
MFKKHKYRILFAIMALLPLLAKVDPNDWWYIG

Nucleotide


Download         Length: 96 bp        

>NTDB_id=569 25330..25425(-) (comS) [Streptococcus parauberis KRS-02109]
ATGTTCAAAAAACACAAATACCGTATTTTATTTGCCATCATGGCACTTTTGCCCTTGCTAGCAAAAGTGGATCCTAATGA
TTGGTGGTACATCGGA

XIP

This gene is known to encode the precursor of σX inducing peptide (XIP), which involves in competence development. The mature XIP sequence is displayed as below:

PNDWWYIG


Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value