Detailed information NTG0556660

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: J9537_RS20585
• Genome accession: NZ_CP072888
• Coordinates: 957209..957478 (+)
• Length: 89 a.a.
• NCBI ID: WP_010746556.1
• Uniprot ID: A0AAW8TC89
• Organism: Enterococcus raffinosus strain F162_2
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 952209..962478

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J9537_RS04710 (J9537_04710)	dat	952378..953247 (+)	870	WP_218256905.1	D-amino-acid transaminase	-
J9537_RS04715 (J9537_04715)	-	953337..954119 (+)	783	WP_010746560.1	phosphotransferase family protein	-
J9537_RS04720 (J9537_04720)	trmB	954544..955194 (+)	651	WP_010746559.1	tRNA (guanosine(46)-N7)-methyltransferase TrmB	-
J9537_RS04725 (J9537_04725)	comGA	955288..956220 (+)	933	WP_218256906.1	competence type IV pilus ATPase ComGA	-
J9537_RS04730 (J9537_04730)	comGB	956199..957212 (+)	1014	WP_218256907.1	competence type IV pilus assembly protein ComGB	-
J9537_RS20585 (J9537_04735)	comYC	957209..957478 (+)	270	WP_010746556.1	competence type IV pilus major pilin ComGC	Machinery gene
J9537_RS04740 (J9537_04740)	comGD	957450..957917 (+)	468	WP_218256909.1	competence type IV pilus minor pilin ComGD	-
J9537_RS04745 (J9537_04745)	comGE	957895..958176 (+)	282	WP_245001291.1	competence type IV pilus minor pilin ComGE	-
J9537_RS04750 (J9537_04750)	comGF	958163..958585 (+)	423	WP_218256911.1	competence type IV pilus minor pilin ComGF	-
J9537_RS04755 (J9537_04755)	comGG	958578..958898 (+)	321	WP_218256912.1	competence type IV pilus minor pilin ComGG	-
J9537_RS04760 (J9537_04760)	-	959065..960072 (+)	1008	WP_010746551.1	class I SAM-dependent methyltransferase	-
J9537_RS04765 (J9537_04765)	-	960121..961317 (+)	1197	WP_010746550.1	acetate kinase	-
J9537_RS04770 (J9537_04770)	-	961462..961812 (+)	351	WP_218256913.1	BMC domain-containing protein	-
J9537_RS04775 (J9537_04775)	eutP	961816..962256 (+)	441	WP_218256914.1	EutP/PduV family microcompartment system protein	-

Sequence

Protein

• Length: 89 a.a.
• Molecular weight: 10213.99 Da
• Isoelectric Point: 8.4367

>NTDB_id=556660 J9537_RS20585 WP_010746556.1 957209..957478(+) (comYC) [Enterococcus raffinosus strain F162_2]
MKKKVSGFTLIEMLVVLFVISLLLLLFVPKLINQKDSATKKSDAAIAKVVETQIEVFELDHGRTPSKQELIDQGYVKEKQ
YEAYERNKE

Nucleotide

• Length: 270 bp

>NTDB_id=556660 J9537_RS20585 WP_010746556.1 957209..957478(+) (comYC) [Enterococcus raffinosus strain F162_2]
GTGAAGAAAAAAGTTTCTGGCTTTACATTAATAGAAATGCTAGTTGTTCTTTTCGTAATCAGCTTACTATTACTGCTTTT
TGTACCAAAGCTGATCAATCAAAAAGACAGTGCCACAAAGAAAAGTGATGCGGCTATTGCAAAAGTTGTCGAAACTCAGA
TTGAGGTTTTTGAGTTGGATCATGGTAGAACACCGAGCAAACAAGAATTAATTGATCAGGGCTATGTTAAGGAGAAGCAA
TATGAAGCCTATGAACGCAATAAAGAATAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-26)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	56.471	95.506	0.539
comGC	Lactococcus lactis subsp. cremoris KW2	49.412	95.506	0.472
comGC/cglC	Streptococcus mitis SK321	50.602	93.258	0.472
comGC/cglC	Streptococcus mitis NCTC 12261	50.602	93.258	0.472
comGC/cglC	Streptococcus pneumoniae R6	47.619	94.382	0.449
comGC/cglC	Streptococcus pneumoniae Rx1	47.619	94.382	0.449
comGC/cglC	Streptococcus pneumoniae TIGR4	47.619	94.382	0.449
comGC/cglC	Streptococcus pneumoniae D39	47.619	94.382	0.449
comGC	Latilactobacillus sakei subsp. sakei 23K	43.82	100	0.438
comYC	Streptococcus gordonii str. Challis substr. CH1	44.706	95.506	0.427
comYC	Streptococcus mutans UA140	45.679	91.011	0.416
comYC	Streptococcus mutans UA159	45.679	91.011	0.416
comGC	Staphylococcus aureus N315	45.57	88.764	0.404
comGC	Staphylococcus aureus MW2	45.57	88.764	0.404
comGC	Bacillus subtilis subsp. subtilis str. 168	47.222	80.899	0.382