Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   J9312_RS12570 Genome accession   NZ_CP072845
Coordinates   2341983..2342366 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain XP     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2336983..2347366
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J9312_RS12530 (J9312_12450) sinI 2337917..2338090 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  J9312_RS12535 (J9312_12455) sinR 2338124..2338459 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  J9312_RS12540 (J9312_12460) tasA 2338552..2339337 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  J9312_RS12545 (J9312_12465) sipW 2339401..2339973 (-) 573 WP_003230181.1 signal peptidase I SipW -
  J9312_RS12550 (J9312_12470) tapA 2339957..2340718 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  J9312_RS12555 (J9312_12475) yqzG 2340990..2341316 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  J9312_RS12560 (J9312_12480) spoIITA 2341358..2341537 (-) 180 WP_014480252.1 YqzE family protein -
  J9312_RS12565 (J9312_12485) comGG 2341608..2341982 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  J9312_RS12570 (J9312_12490) comGF 2341983..2342366 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  J9312_RS12575 (J9312_12495) comGE 2342392..2342739 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  J9312_RS12580 (J9312_12500) comGD 2342723..2343154 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  J9312_RS12585 (J9312_12505) comGC 2343144..2343440 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  J9312_RS12590 (J9312_12510) comGB 2343454..2344491 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  J9312_RS12595 (J9312_12515) comGA 2344478..2345548 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  J9312_RS12600 (J9312_12520) - 2345760..2345957 (-) 198 WP_014480259.1 CBS domain-containing protein -
  J9312_RS12605 (J9312_12525) corA 2345959..2346912 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=556205 J9312_RS12570 WP_014480254.1 2341983..2342366(-) (comGF) [Bacillus subtilis strain XP]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=556205 J9312_RS12570 WP_014480254.1 2341983..2342366(-) (comGF) [Bacillus subtilis strain XP]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984