Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   J5W00_RS19140 Genome accession   NZ_CP072055
Coordinates   3781089..3781868 (-) Length   259 a.a.
NCBI ID   WP_002014541.1    Uniprot ID   -
Organism   Bacillus mycoides strain JAS85/1     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3749566..3816578 3781089..3781868 within 0


Gene organization within MGE regions


Location: 3749566..3816578
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J5W00_RS18995 (J5W00_18995) dapA 3749630..3750508 (-) 879 WP_002014579.1 4-hydroxy-tetrahydrodipicolinate synthase -
  J5W00_RS19000 (J5W00_19000) dapG 3750520..3751752 (-) 1233 WP_033731191.1 aspartate kinase -
  J5W00_RS19005 (J5W00_19005) asd 3751776..3752822 (-) 1047 WP_002014577.1 aspartate-semialdehyde dehydrogenase -
  J5W00_RS19010 (J5W00_19010) dpaB 3752972..3753571 (-) 600 WP_002111357.1 dipicolinate synthase subunit B -
  J5W00_RS19015 (J5W00_19015) dpaA 3753568..3754470 (-) 903 WP_002088148.1 dipicolinic acid synthetase subunit A -
  J5W00_RS19020 (J5W00_19020) - 3754643..3754891 (-) 249 WP_050000361.1 YlmC/YmxH family sporulation protein -
  J5W00_RS19025 (J5W00_19025) - 3755027..3756268 (-) 1242 WP_002088150.1 pitrilysin family protein -
  J5W00_RS19030 (J5W00_19030) - 3756355..3757254 (-) 900 WP_215577319.1 polysaccharide deacetylase family protein -
  J5W00_RS19035 (J5W00_19035) pnp 3757409..3759562 (-) 2154 WP_002033682.1 polyribonucleotide nucleotidyltransferase -
  J5W00_RS19040 (J5W00_19040) rpsO 3759724..3759993 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  J5W00_RS19045 (J5W00_19045) ribF 3760094..3761065 (-) 972 WP_002128800.1 bifunctional riboflavin kinase/FAD synthetase -
  J5W00_RS19050 (J5W00_19050) truB 3761109..3762032 (-) 924 WP_078206256.1 tRNA pseudouridine(55) synthase TruB -
  J5W00_RS19055 (J5W00_19055) rbfA 3762123..3762479 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  J5W00_RS19060 (J5W00_19060) - 3762495..3762776 (-) 282 WP_002088157.1 DUF503 domain-containing protein -
  J5W00_RS19065 (J5W00_19065) infB 3762773..3764839 (-) 2067 WP_002014558.1 translation initiation factor IF-2 -
  J5W00_RS19070 (J5W00_19070) - 3764844..3765155 (-) 312 WP_001286519.1 YlxQ family RNA-binding protein -
  J5W00_RS19075 (J5W00_19075) rnpM 3765156..3765428 (-) 273 WP_002088161.1 RNase P modulator RnpM -
  J5W00_RS19080 (J5W00_19080) nusA 3765440..3766546 (-) 1107 WP_002014554.1 transcription termination factor NusA -
  J5W00_RS19085 (J5W00_19085) rimP 3766564..3767034 (-) 471 WP_002088165.1 ribosome maturation factor RimP -
  J5W00_RS19090 (J5W00_19090) - 3767368..3771669 (-) 4302 WP_215577320.1 PolC-type DNA polymerase III -
  J5W00_RS19095 (J5W00_19095) - 3771794..3773494 (-) 1701 WP_002128803.1 proline--tRNA ligase -
  J5W00_RS19100 (J5W00_19100) rseP 3773604..3774860 (-) 1257 WP_113936801.1 RIP metalloprotease RseP -
  J5W00_RS19105 (J5W00_19105) dxr 3774878..3776020 (-) 1143 WP_002014547.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  J5W00_RS19110 (J5W00_19110) cdsA 3776044..3776835 (-) 792 WP_002088171.1 phosphatidate cytidylyltransferase -
  J5W00_RS19115 (J5W00_19115) - 3776853..3777629 (-) 777 WP_002014545.1 isoprenyl transferase -
  J5W00_RS19120 (J5W00_19120) frr 3777715..3778272 (-) 558 WP_000531506.1 ribosome recycling factor -
  J5W00_RS19125 (J5W00_19125) pyrH 3778276..3778998 (-) 723 WP_002014544.1 UMP kinase -
  J5W00_RS19130 (J5W00_19130) tsf 3779065..3779952 (-) 888 WP_002088177.1 translation elongation factor Ts -
  J5W00_RS19135 (J5W00_19135) rpsB 3780035..3780736 (-) 702 WP_002185070.1 30S ribosomal protein S2 -
  J5W00_RS19140 (J5W00_19140) codY 3781089..3781868 (-) 780 WP_002014541.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  J5W00_RS19145 (J5W00_19145) hslU 3781946..3783337 (-) 1392 WP_002014539.1 ATP-dependent protease ATPase subunit HslU -
  J5W00_RS19150 (J5W00_19150) hslV 3783360..3783902 (-) 543 WP_002014538.1 ATP-dependent protease proteolytic subunit HslV -
  J5W00_RS19155 (J5W00_19155) xerC 3783945..3784844 (-) 900 WP_078175468.1 tyrosine recombinase XerC -
  J5W00_RS19160 (J5W00_19160) trmFO 3784916..3786220 (-) 1305 WP_002066796.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  J5W00_RS19165 (J5W00_19165) topA 3786269..3788347 (-) 2079 WP_002088184.1 type I DNA topoisomerase -
  J5W00_RS19170 (J5W00_19170) dprA 3788492..3789361 (-) 870 WP_002167750.1 DNA-processing protein DprA -
  J5W00_RS19175 (J5W00_19175) sucD 3789450..3790352 (-) 903 WP_002033796.1 succinate--CoA ligase subunit alpha -
  J5W00_RS19180 (J5W00_19180) sucC 3790372..3791532 (-) 1161 WP_002014529.1 ADP-forming succinate--CoA ligase subunit beta -
  J5W00_RS19185 (J5W00_19185) - 3791726..3792499 (-) 774 WP_002014527.1 ribonuclease HII -
  J5W00_RS19190 (J5W00_19190) ylqF 3792555..3793445 (-) 891 WP_002128821.1 ribosome biogenesis GTPase YlqF -
  J5W00_RS19195 (J5W00_19195) lepB 3793466..3794017 (-) 552 WP_002066791.1 signal peptidase I -
  J5W00_RS19200 (J5W00_19200) rplS 3794118..3794462 (-) 345 WP_002014524.1 50S ribosomal protein L19 -
  J5W00_RS19205 (J5W00_19205) trmD 3794609..3795343 (-) 735 WP_002014522.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  J5W00_RS19210 (J5W00_19210) rimM 3795343..3795858 (-) 516 WP_002014521.1 ribosome maturation factor RimM -
  J5W00_RS19215 (J5W00_19215) - 3795980..3796207 (-) 228 WP_002088196.1 KH domain-containing protein -
  J5W00_RS19220 (J5W00_19220) rpsP 3796222..3796494 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  J5W00_RS19225 (J5W00_19225) ffh 3796595..3797944 (-) 1350 WP_002014519.1 signal recognition particle protein -
  J5W00_RS19230 (J5W00_19230) - 3797957..3798289 (-) 333 WP_000891061.1 putative DNA-binding protein -
  J5W00_RS19235 (J5W00_19235) ftsY 3798422..3799411 (-) 990 WP_002088200.1 signal recognition particle-docking protein FtsY -
  J5W00_RS19240 (J5W00_19240) smc 3799426..3802995 (-) 3570 WP_002014517.1 chromosome segregation protein SMC -
  J5W00_RS19245 (J5W00_19245) rncS 3803144..3803881 (-) 738 WP_002033792.1 ribonuclease III -
  J5W00_RS19250 (J5W00_19250) acpP 3803940..3804173 (-) 234 WP_002014515.1 acyl carrier protein -
  J5W00_RS19255 (J5W00_19255) fabG 3804243..3804983 (-) 741 WP_002014514.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  J5W00_RS19260 (J5W00_19260) fabD 3804983..3805927 (-) 945 WP_002128825.1 ACP S-malonyltransferase -
  J5W00_RS19265 (J5W00_19265) plsX 3805942..3806934 (-) 993 WP_002128828.1 phosphate acyltransferase PlsX -
  J5W00_RS19270 (J5W00_19270) fapR 3806931..3807524 (-) 594 WP_000747354.1 transcription factor FapR -
  J5W00_RS19275 (J5W00_19275) recG 3807613..3809661 (-) 2049 WP_002014510.1 ATP-dependent DNA helicase RecG -
  J5W00_RS19280 (J5W00_19280) - 3810086..3811762 (-) 1677 WP_002128829.1 DAK2 domain-containing protein -
  J5W00_RS19285 (J5W00_19285) - 3811785..3812147 (-) 363 WP_002014507.1 Asp23/Gls24 family envelope stress response protein -
  J5W00_RS19290 (J5W00_19290) rpmB 3812526..3812714 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  J5W00_RS19295 (J5W00_19295) spoVM 3812788..3812868 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  J5W00_RS19300 (J5W00_19300) - 3812935..3813615 (-) 681 WP_215577321.1 thiamine diphosphokinase -
  J5W00_RS19305 (J5W00_19305) rpe 3813716..3814360 (-) 645 WP_002014505.1 ribulose-phosphate 3-epimerase -
  J5W00_RS19310 (J5W00_19310) rsgA 3814363..3815244 (-) 882 WP_002014503.1 ribosome small subunit-dependent GTPase A -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.99 Da        Isoelectric Point: 4.7251

>NTDB_id=550239 J5W00_RS19140 WP_002014541.1 3781089..3781868(-) (codY) [Bacillus mycoides strain JAS85/1]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKHMLAERQFPEEYTQSLF
NVTETSSNLGVDSDYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=550239 J5W00_RS19140 WP_002014541.1 3781089..3781868(-) (codY) [Bacillus mycoides strain JAS85/1]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAGAT
GTCTGACACAATGTGTGAAGTAATTGAAGCGAACGTGTTCGTTGTAAGTCGTCGCGGTAAATTATTAGGATATGCGATTC
ACCAACAAATCGAAAACGAACGTATGAAGCACATGCTTGCAGAGCGTCAATTCCCAGAAGAGTATACGCAAAGTTTATTC
AATGTTACAGAAACATCTTCAAATTTAGGTGTGGATAGTGACTACACAGCATTCCCGGTAGAAAATAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACACTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGACGATGATTTAATTCTTGCTGAATACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCGATTAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
CGAGCATATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTCGGAATTACTC
GTTCGGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAGGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY helix-turn-helix domain (HTH_CodY)

(198-255)

CodY GAF-like domain (CodY)

(2-178)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.275

98.456

0.456