Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   BEST7003_RS11820 Genome accession   NZ_AP012496
Coordinates   2388307..2388690 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis BEST7003     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2383307..2393690
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BEST7003_RS11780 (BEST7003_2318) sinI 2384241..2384414 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BEST7003_RS11785 (BEST7003_2319) sinR 2384448..2384783 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BEST7003_RS11790 (BEST7003_2320) tasA 2384876..2385661 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  BEST7003_RS11795 (BEST7003_2321) sipW 2385725..2386297 (-) 573 WP_003246088.1 signal peptidase I SipW -
  BEST7003_RS11800 (BEST7003_2322) tapA 2386281..2387042 (-) 762 Protein_2360 amyloid fiber anchoring/assembly protein TapA -
  BEST7003_RS11805 (BEST7003_2324) yqzG 2387314..2387640 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BEST7003_RS11810 (BEST7003_2325) spoIITA 2387682..2387861 (-) 180 WP_003230176.1 YqzE family protein -
  BEST7003_RS11815 (BEST7003_2326) comGG 2387932..2388306 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  BEST7003_RS11820 (BEST7003_2327) comGF 2388307..2388690 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  BEST7003_RS11825 (BEST7003_2328) comGE 2388716..2389063 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  BEST7003_RS11830 (BEST7003_2329) comGD 2389047..2389478 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  BEST7003_RS11835 (BEST7003_2330) comGC 2389468..2389764 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  BEST7003_RS11840 (BEST7003_2331) comGB 2389778..2390815 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  BEST7003_RS11845 (BEST7003_2332) comGA 2390802..2391872 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  BEST7003_RS11850 (BEST7003_2333) corA 2392284..2393237 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=54988 BEST7003_RS11820 WP_003230168.1 2388307..2388690(-) (comGF) [Bacillus subtilis BEST7003]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=54988 BEST7003_RS11820 WP_003230168.1 2388307..2388690(-) (comGF) [Bacillus subtilis BEST7003]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment