Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   LJA36_RS17325 Genome accession   NZ_CP085282
Coordinates   3569597..3569911 (+) Length   104 a.a.
NCBI ID   WP_031378943.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain TPS17     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3564597..3574911
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LJA36_RS17300 - 3565637..3566587 (+) 951 WP_015417820.1 magnesium transporter CorA family protein -
  LJA36_RS17305 comGA 3566780..3567849 (+) 1070 Protein_3365 competence type IV pilus ATPase ComGA -
  LJA36_RS17310 comGB 3567836..3568873 (+) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  LJA36_RS17315 comGC 3568878..3569186 (+) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  LJA36_RS17320 comGD 3569176..3569613 (+) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  LJA36_RS17325 comGE 3569597..3569911 (+) 315 WP_031378943.1 competence type IV pilus minor pilin ComGE Machinery gene
  LJA36_RS17330 comGF 3569820..3570320 (+) 501 WP_258548905.1 competence type IV pilus minor pilin ComGF Machinery gene
  LJA36_RS17335 comGG 3570321..3570698 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  LJA36_RS17340 - 3570755..3570934 (+) 180 WP_003153093.1 YqzE family protein -
  LJA36_RS17345 - 3570974..3571303 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LJA36_RS17350 tapA 3571562..3572233 (+) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  LJA36_RS17355 sipW 3572205..3572789 (+) 585 WP_015240205.1 signal peptidase I SipW -
  LJA36_RS17360 tasA 3572854..3573639 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  LJA36_RS17365 sinR 3573687..3574022 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LJA36_RS17370 sinI 3574056..3574229 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11932.95 Da        Isoelectric Point: 7.8118

>NTDB_id=538153 LJA36_RS17325 WP_031378943.1 3569597..3569911(+) (comGE) [Bacillus amyloliquefaciens strain TPS17]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYRLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCTADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=538153 LJA36_RS17325 WP_031378943.1 3569597..3569911(+) (comGE) [Bacillus amyloliquefaciens strain TPS17]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCGGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTACGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

41.739

100

0.462