Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   I6J09_RS10090 Genome accession   NZ_CP068216
Coordinates   2107496..2107945 (+) Length   149 a.a.
NCBI ID   WP_208969801.1    Uniprot ID   -
Organism   Staphylococcus pasteuri strain FDAARGOS_1152     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2097129..2147480 2107496..2107945 within 0


Gene organization within MGE regions


Location: 2097129..2147480
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6J09_RS10000 (I6J09_09995) whiA 2097129..2098073 (+) 945 WP_208969788.1 DNA-binding protein WhiA -
  I6J09_RS10005 (I6J09_10000) - 2098210..2099247 (-) 1038 WP_108017228.1 tyrosine-type recombinase/integrase -
  I6J09_RS10010 (I6J09_10005) - 2099302..2100093 (-) 792 WP_208969789.1 DUF1828 domain-containing protein -
  I6J09_RS10015 (I6J09_10010) - 2100098..2100571 (-) 474 WP_208969790.1 DUF6978 family protein -
  I6J09_RS10020 (I6J09_10015) - 2100605..2100865 (-) 261 WP_208969791.1 helix-turn-helix domain-containing protein -
  I6J09_RS10025 (I6J09_10020) - 2100999..2101523 (-) 525 WP_208969792.1 hypothetical protein -
  I6J09_RS10030 (I6J09_10025) - 2101498..2101899 (-) 402 WP_208969793.1 sporulation protein -
  I6J09_RS10035 (I6J09_10030) - 2103144..2103311 (-) 168 WP_208969794.1 hypothetical protein -
  I6J09_RS10040 (I6J09_10035) - 2103356..2103436 (-) 81 Protein_1942 transcriptional regulator -
  I6J09_RS10045 (I6J09_10040) - 2103436..2104074 (-) 639 WP_046464317.1 XRE family transcriptional regulator -
  I6J09_RS10050 (I6J09_10045) - 2104265..2104525 (+) 261 WP_208969795.1 helix-turn-helix transcriptional regulator -
  I6J09_RS10055 (I6J09_10050) - 2104539..2105294 (+) 756 WP_208969796.1 phage antirepressor KilAC domain-containing protein -
  I6J09_RS10060 (I6J09_10055) - 2105615..2105818 (-) 204 WP_208969797.1 hypothetical protein -
  I6J09_RS10065 (I6J09_10060) - 2105877..2106194 (+) 318 WP_126567609.1 DUF771 domain-containing protein -
  I6J09_RS10070 (I6J09_10065) - 2106197..2106370 (+) 174 WP_208969798.1 hypothetical protein -
  I6J09_RS10075 (I6J09_10070) - 2106442..2106669 (+) 228 WP_208969799.1 hypothetical protein -
  I6J09_RS10080 (I6J09_10075) - 2106641..2106868 (+) 228 WP_108017081.1 DUF2483 family protein -
  I6J09_RS10085 (I6J09_10080) - 2106861..2107496 (+) 636 WP_208969800.1 ERF family protein -
  I6J09_RS10090 (I6J09_10085) ssbA 2107496..2107945 (+) 450 WP_208969801.1 single-stranded DNA-binding protein Machinery gene
  I6J09_RS10095 (I6J09_10090) - 2107957..2108640 (+) 684 WP_208969802.1 putative HNHc nuclease -
  I6J09_RS10100 (I6J09_10095) - 2108646..2109128 (-) 483 WP_208969803.1 hypothetical protein -
  I6J09_RS10105 (I6J09_10100) - 2109175..2109405 (+) 231 WP_208969804.1 helix-turn-helix transcriptional regulator -
  I6J09_RS10110 (I6J09_10105) - 2109408..2110148 (+) 741 WP_208970082.1 helix-turn-helix domain-containing protein -
  I6J09_RS10115 (I6J09_10110) - 2110161..2110946 (+) 786 WP_208969805.1 ATP-binding protein -
  I6J09_RS12555 - 2110943..2111101 (+) 159 WP_236582534.1 hypothetical protein -
  I6J09_RS10120 (I6J09_10115) - 2111113..2111337 (+) 225 WP_208969806.1 DUF3269 family protein -
  I6J09_RS10125 (I6J09_10120) - 2111347..2111754 (+) 408 WP_208969807.1 RusA family crossover junction endodeoxyribonuclease -
  I6J09_RS10130 (I6J09_10125) - 2111755..2111913 (+) 159 WP_208969808.1 hypothetical protein -
  I6J09_RS10135 (I6J09_10130) - 2111925..2112275 (+) 351 WP_017636915.1 helix-turn-helix domain-containing protein -
  I6J09_RS10140 (I6J09_10135) - 2112277..2112534 (+) 258 WP_017636914.1 hypothetical protein -
  I6J09_RS10145 (I6J09_10140) - 2112770..2112979 (+) 210 Protein_1964 DUF3310 domain-containing protein -
  I6J09_RS10150 (I6J09_10145) - 2112981..2113208 (+) 228 WP_208969810.1 hypothetical protein -
  I6J09_RS10155 (I6J09_10150) - 2113214..2113750 (+) 537 WP_208969811.1 HNH endonuclease signature motif containing protein -
  I6J09_RS10160 (I6J09_10155) - 2113809..2113991 (+) 183 WP_208969812.1 hypothetical protein -
  I6J09_RS10165 (I6J09_10160) - 2113981..2114181 (+) 201 WP_208970083.1 hypothetical protein -
  I6J09_RS10170 (I6J09_10165) - 2114178..2114534 (+) 357 WP_017636910.1 thermonuclease family protein -
  I6J09_RS10175 (I6J09_10170) - 2114556..2114876 (+) 321 WP_017636909.1 MazG-like family protein -
  I6J09_RS10180 (I6J09_10175) - 2114913..2115170 (+) 258 WP_017636908.1 hypothetical protein -
  I6J09_RS10185 (I6J09_10180) - 2115176..2115445 (+) 270 WP_208969813.1 hypothetical protein -
  I6J09_RS10190 (I6J09_10185) - 2115445..2115591 (+) 147 WP_208969814.1 DUF1381 domain-containing protein -
  I6J09_RS10195 (I6J09_10190) - 2115588..2115824 (+) 237 WP_208969815.1 hypothetical protein -
  I6J09_RS10200 (I6J09_10195) rinB 2115817..2115993 (+) 177 WP_208969816.1 transcriptional activator RinB -
  I6J09_RS10205 (I6J09_10200) - 2115999..2116223 (+) 225 WP_200271295.1 hypothetical protein -
  I6J09_RS10210 (I6J09_10205) - 2116223..2116426 (+) 204 WP_017636904.1 DUF1514 family protein -
  I6J09_RS10215 (I6J09_10210) - 2116512..2116886 (+) 375 WP_208969817.1 SA1788 family PVL leukocidin-associated protein -
  I6J09_RS10220 (I6J09_10215) - 2116995..2117408 (+) 414 WP_208969818.1 hypothetical protein -
  I6J09_RS10225 (I6J09_10220) - 2117623..2117934 (+) 312 WP_154836109.1 HNH endonuclease -
  I6J09_RS10230 (I6J09_10225) - 2118075..2118425 (+) 351 WP_070653714.1 hypothetical protein -
  I6J09_RS10235 (I6J09_10230) - 2118422..2120074 (+) 1653 WP_208969819.1 terminase TerL endonuclease subunit -
  I6J09_RS10240 (I6J09_10235) - 2120086..2121249 (+) 1164 WP_208969820.1 phage portal protein -
  I6J09_RS10245 (I6J09_10240) - 2121239..2122009 (+) 771 WP_208969821.1 head maturation protease, ClpP-related -
  I6J09_RS10250 (I6J09_10245) - 2122027..2123247 (+) 1221 WP_029056523.1 phage major capsid protein -
  I6J09_RS10255 (I6J09_10250) - 2123260..2123430 (+) 171 WP_177244129.1 hypothetical protein -
  I6J09_RS10260 (I6J09_10255) - 2123436..2123723 (+) 288 WP_208969822.1 hypothetical protein -
  I6J09_RS10265 (I6J09_10260) - 2123707..2124057 (+) 351 WP_208969823.1 phage head-tail adapter protein -
  I6J09_RS10270 (I6J09_10265) - 2124054..2124449 (+) 396 WP_208969824.1 hypothetical protein -
  I6J09_RS10275 (I6J09_10270) - 2124450..2124854 (+) 405 WP_108017056.1 hypothetical protein -
  I6J09_RS10280 (I6J09_10275) - 2124919..2125608 (+) 690 WP_154836119.1 major tail protein -
  I6J09_RS10285 (I6J09_10280) gpG 2125708..2126025 (+) 318 WP_029056527.1 phage tail assembly chaperone G -
  I6J09_RS10290 (I6J09_10285) - 2126103..2126261 (+) 159 WP_002452342.1 hypothetical protein -
  I6J09_RS10295 (I6J09_10290) - 2126302..2132139 (+) 5838 WP_208969825.1 peptidoglycan DD-metalloendopeptidase family protein -
  I6J09_RS10300 (I6J09_10295) - 2132143..2133633 (+) 1491 WP_208969826.1 phage distal tail protein -
  I6J09_RS10305 (I6J09_10300) - 2133646..2137176 (+) 3531 WP_208969827.1 phage tail spike protein -
  I6J09_RS10310 (I6J09_10305) - 2137166..2137312 (+) 147 WP_208969828.1 hypothetical protein -
  I6J09_RS10315 (I6J09_10310) - 2137356..2137643 (+) 288 WP_017636884.1 hypothetical protein -
  I6J09_RS10320 (I6J09_10315) - 2137682..2138098 (+) 417 WP_414075515.1 hypothetical protein -
  I6J09_RS10325 (I6J09_10320) - 2138085..2138486 (+) 402 WP_017636882.1 hypothetical protein -
  I6J09_RS10330 (I6J09_10325) - 2138538..2138789 (+) 252 WP_017636881.1 phage holin -
  I6J09_RS10335 (I6J09_10330) - 2138801..2140213 (+) 1413 WP_208969829.1 N-acetylmuramoyl-L-alanine amidase -
  I6J09_RS12605 - 2140432..2140563 (+) 132 WP_017636879.1 hypothetical protein -
  I6J09_RS10340 (I6J09_10335) - 2140753..2140950 (+) 198 WP_017636877.1 hypothetical protein -
  I6J09_RS10350 (I6J09_10345) clpP 2142384..2142974 (+) 591 WP_017636876.1 ATP-dependent Clp endopeptidase proteolytic subunit ClpP -
  I6J09_RS10355 (I6J09_10350) - 2143100..2143318 (-) 219 WP_119622469.1 hypothetical protein -
  I6J09_RS10360 (I6J09_10355) - 2143335..2144234 (-) 900 WP_119622470.1 TIGR01777 family oxidoreductase -
  I6J09_RS10365 (I6J09_10360) - 2145011..2145706 (+) 696 WP_208969830.1 DUF4887 domain-containing protein -
  I6J09_RS10370 (I6J09_10365) - 2145814..2146035 (-) 222 WP_017636871.1 hypothetical protein -
  I6J09_RS10375 (I6J09_10370) - 2146467..2147480 (+) 1014 WP_029056541.1 sugar-binding transcriptional regulator -

Sequence


Protein


Download         Length: 149 a.a.        Molecular weight: 16571.13 Da        Isoelectric Point: 4.6838

>NTDB_id=528157 I6J09_RS10090 WP_208969801.1 2107496..2107945(+) (ssbA) [Staphylococcus pasteuri strain FDAARGOS_1152]
MLNRVVLVGRLTKDPEFRTTPNGVNVATFTLAVNRTFTNAQGEREADFINSVTFRKQADNVNNYLSKGSLVGVDGRVQSR
SYENQEGKRVFVTEVVCDSVQFLEPKNNNQSNNQPQQQNGQTQSGNNPFENGMQNANGPIDISDDDLPF

Nucleotide


Download         Length: 450 bp        

>NTDB_id=528157 I6J09_RS10090 WP_208969801.1 2107496..2107945(+) (ssbA) [Staphylococcus pasteuri strain FDAARGOS_1152]
ATGTTAAACAGAGTTGTATTAGTAGGAAGATTAACGAAAGACCCGGAATTTAGAACGACACCAAATGGTGTAAATGTTGC
CACTTTCACATTAGCAGTGAATAGAACATTTACAAATGCTCAAGGAGAACGTGAGGCAGATTTTATTAACTCTGTAACTT
TTAGAAAGCAAGCAGACAACGTAAACAACTATTTATCAAAAGGGTCGTTAGTTGGAGTTGATGGACGTGTGCAATCGCGT
AGTTATGAAAATCAAGAGGGCAAACGCGTATTTGTTACTGAGGTAGTTTGTGATAGCGTCCAATTTTTAGAACCGAAGAA
TAATAACCAATCTAACAACCAACCACAACAACAAAACGGACAAACTCAAAGTGGTAATAATCCGTTCGAAAATGGTATGC
AAAACGCTAATGGACCTATAGACATTTCAGATGATGACCTACCTTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

59.884

100

0.691

  ssb Latilactobacillus sakei subsp. sakei 23K

54.07

100

0.624

  ssbB Bacillus subtilis subsp. subtilis str. 168

60.377

71.141

0.43

  ssb Glaesserella parasuis strain SC1401

32.768

100

0.389

  ssbA Streptococcus mutans UA159

36.242

100

0.362