Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   B657_RS13370 Genome accession   NC_018520
Coordinates   2536016..2536399 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis QB928     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2531016..2541399
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B657_RS13330 (B657_24600) sinI 2531950..2532123 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  B657_RS13335 (B657_24610) sinR 2532157..2532492 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  B657_RS13340 (B657_24620) tasA 2532585..2533370 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  B657_RS13345 (B657_24630) sipW 2533434..2534006 (-) 573 WP_003246088.1 signal peptidase I SipW -
  B657_RS13350 (B657_24640) tapA 2533990..2534751 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  B657_RS13355 (B657_24650) yqzG 2535023..2535349 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  B657_RS13360 (B657_24660) spoIITA 2535391..2535570 (-) 180 WP_003230176.1 YqzE family protein -
  B657_RS13365 (B657_24670) comGG 2535641..2536015 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  B657_RS13370 (B657_24680) comGF 2536016..2536399 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  B657_RS13375 (B657_24690) comGE 2536425..2536772 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  B657_RS13380 (B657_24700) comGD 2536756..2537187 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  B657_RS13385 (B657_24710) comGC 2537177..2537473 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  B657_RS13390 (B657_24720) comGB 2537487..2538524 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  B657_RS13395 (B657_24730) comGA 2538511..2539581 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  B657_RS13405 (B657_24740) corA 2539993..2540946 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=52605 B657_RS13370 WP_003230168.1 2536016..2536399(-) (comGF) [Bacillus subtilis QB928]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=52605 B657_RS13370 WP_003230168.1 2536016..2536399(-) (comGF) [Bacillus subtilis QB928]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment