Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   U471_RS11445 Genome accession   NC_022653
Coordinates   2427231..2427545 (-) Length   104 a.a.
NCBI ID   WP_012117982.1    Uniprot ID   A7Z6N6
Organism   Bacillus amyloliquefaciens CC178     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2422231..2432545
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U471_RS11400 (U471_23710) sinI 2422913..2423086 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  U471_RS11405 (U471_23720) sinR 2423120..2423455 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  U471_RS11410 (U471_23730) tasA 2423503..2424288 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  U471_RS11415 (U471_23740) sipW 2424353..2424937 (-) 585 WP_012117977.1 signal peptidase I SipW -
  U471_RS11420 (U471_23750) tapA 2424909..2425580 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  U471_RS11425 (U471_23780) - 2425839..2426168 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  U471_RS11430 (U471_23790) - 2426208..2426387 (-) 180 WP_003153093.1 YqzE family protein -
  U471_RS11435 (U471_23800) comGG 2426444..2426821 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  U471_RS11440 (U471_23810) comGF 2426822..2427322 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  U471_RS11445 (U471_23820) comGE 2427231..2427545 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE Machinery gene
  U471_RS11450 (U471_23830) comGD 2427529..2427966 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  U471_RS11455 (U471_23840) comGC 2427956..2428222 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  U471_RS11460 (U471_23850) comGB 2428269..2429306 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  U471_RS11465 (U471_23860) comGA 2429293..2430363 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  U471_RS11470 (U471_23870) - 2430560..2431510 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11904.90 Da        Isoelectric Point: 6.9470

>NTDB_id=52373 U471_RS11445 WP_012117982.1 2427231..2427545(-) (comGE) [Bacillus amyloliquefaciens CC178]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCTADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=52373 U471_RS11445 WP_012117982.1 2427231..2427545(-) (comGE) [Bacillus amyloliquefaciens CC178]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTACGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6N6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

42.609

100

0.471

Multiple sequence alignment