Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   I0K14_RS18020 Genome accession   NZ_CP065149
Coordinates   3541545..3542324 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus paranthracis strain Gxun-30     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3514924..3560956 3541545..3542324 within 0


Gene organization within MGE regions


Location: 3514924..3560956
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I0K14_RS17900 (I0K14_17900) - 3515118..3515369 (-) 252 WP_001239753.1 YlmC/YmxH family sporulation protein -
  I0K14_RS17905 (I0K14_17905) - 3515496..3516737 (-) 1242 WP_000592994.1 M16 family metallopeptidase -
  I0K14_RS17910 (I0K14_17910) - 3516824..3517723 (-) 900 WP_000857421.1 polysaccharide deacetylase family protein -
  I0K14_RS17915 (I0K14_17915) pnp 3517876..3520014 (-) 2139 WP_000076746.1 polyribonucleotide nucleotidyltransferase -
  I0K14_RS17920 (I0K14_17920) rpsO 3520175..3520444 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  I0K14_RS17925 (I0K14_17925) ribF 3520545..3521516 (-) 972 WP_000766710.1 bifunctional riboflavin kinase/FAD synthetase -
  I0K14_RS17930 (I0K14_17930) truB 3521560..3522483 (-) 924 WP_000399341.1 tRNA pseudouridine(55) synthase TruB -
  I0K14_RS17935 (I0K14_17935) rbfA 3522570..3522926 (-) 357 WP_000776443.1 30S ribosome-binding factor RbfA -
  I0K14_RS17940 (I0K14_17940) - 3522942..3523223 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  I0K14_RS17945 (I0K14_17945) infB 3523220..3525280 (-) 2061 WP_000036342.1 translation initiation factor IF-2 -
  I0K14_RS17950 (I0K14_17950) - 3525285..3525596 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  I0K14_RS17955 (I0K14_17955) rnpM 3525597..3525869 (-) 273 WP_000071128.1 RNase P modulator RnpM -
  I0K14_RS17960 (I0K14_17960) nusA 3525881..3526987 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  I0K14_RS17965 (I0K14_17965) rimP 3527005..3527475 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  I0K14_RS17970 (I0K14_17970) - 3527808..3532109 (-) 4302 WP_000059980.1 PolC-type DNA polymerase III -
  I0K14_RS17975 (I0K14_17975) - 3532234..3533934 (-) 1701 WP_000814314.1 proline--tRNA ligase -
  I0K14_RS17980 (I0K14_17980) rseP 3534044..3535300 (-) 1257 WP_001090249.1 RIP metalloprotease RseP -
  I0K14_RS17985 (I0K14_17985) dxr 3535317..3536459 (-) 1143 WP_000790366.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  I0K14_RS17990 (I0K14_17990) cdsA 3536483..3537274 (-) 792 WP_000813584.1 phosphatidate cytidylyltransferase -
  I0K14_RS17995 (I0K14_17995) uppS 3537292..3538068 (-) 777 WP_000971301.1 isoprenyl transferase -
  I0K14_RS18000 (I0K14_18000) frr 3538154..3538711 (-) 558 WP_000531500.1 ribosome recycling factor -
  I0K14_RS18005 (I0K14_18005) pyrH 3538714..3539436 (-) 723 WP_000042663.1 UMP kinase -
  I0K14_RS18010 (I0K14_18010) tsf 3539503..3540390 (-) 888 WP_001018580.1 translation elongation factor Ts -
  I0K14_RS18015 (I0K14_18015) rpsB 3540494..3541195 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  I0K14_RS18020 (I0K14_18020) codY 3541545..3542324 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  I0K14_RS18025 (I0K14_18025) hslU 3542402..3543793 (-) 1392 WP_000550081.1 ATP-dependent protease ATPase subunit HslU -
  I0K14_RS18030 (I0K14_18030) hslV 3543816..3544358 (-) 543 WP_000526271.1 ATP-dependent protease proteolytic subunit HslV -
  I0K14_RS18035 (I0K14_18035) xerC 3544401..3545300 (-) 900 WP_001101228.1 tyrosine recombinase XerC -
  I0K14_RS18040 (I0K14_18040) trmFO 3545366..3546670 (-) 1305 WP_001998091.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  I0K14_RS18045 (I0K14_18045) topA 3546721..3548799 (-) 2079 WP_001286973.1 type I DNA topoisomerase -
  I0K14_RS18050 (I0K14_18050) dprA 3548944..3549813 (-) 870 WP_000818025.1 DNA-processing protein DprA -
  I0K14_RS18055 (I0K14_18055) sucD 3549901..3550803 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  I0K14_RS18060 (I0K14_18060) sucC 3550823..3551983 (-) 1161 WP_001020785.1 ADP-forming succinate--CoA ligase subunit beta -
  I0K14_RS18065 (I0K14_18065) rnhB 3552177..3552950 (-) 774 WP_001174725.1 ribonuclease HII -
  I0K14_RS18070 (I0K14_18070) ylqF 3553002..3553892 (-) 891 WP_000236700.1 ribosome biogenesis GTPase YlqF -
  I0K14_RS18075 (I0K14_18075) lepB 3553913..3554464 (-) 552 WP_000711857.1 signal peptidase I -
  I0K14_RS18080 (I0K14_18080) rplS 3554566..3554910 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  I0K14_RS18085 (I0K14_18085) trmD 3555057..3555791 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  I0K14_RS18090 (I0K14_18090) rimM 3555791..3556306 (-) 516 WP_000170268.1 ribosome maturation factor RimM -
  I0K14_RS18095 (I0K14_18095) - 3556427..3556654 (-) 228 WP_000737403.1 KH domain-containing protein -
  I0K14_RS18100 (I0K14_18100) rpsP 3556669..3556941 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  I0K14_RS18105 (I0K14_18105) ffh 3557042..3558391 (-) 1350 WP_000863461.1 signal recognition particle protein -
  I0K14_RS18110 (I0K14_18110) - 3558404..3558736 (-) 333 WP_000891062.1 putative DNA-binding protein -
  I0K14_RS18115 (I0K14_18115) ftsY 3558870..3559859 (-) 990 WP_000007646.1 signal recognition particle-docking protein FtsY -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=507387 I0K14_RS18020 WP_000421288.1 3541545..3542324(-) (codY) [Bacillus paranthracis strain Gxun-30]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=507387 I0K14_RS18020 WP_000421288.1 3541545..3542324(-) (codY) [Bacillus paranthracis strain Gxun-30]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAGCGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGCTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATTGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTACTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459