Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   I0K03_RS18610 Genome accession   NZ_CP064875
Coordinates   3712793..3713572 (-) Length   259 a.a.
NCBI ID   WP_000421291.1    Uniprot ID   A0A1V6LJD3
Organism   Bacillus toyonensis strain P18     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3687503..3749318 3712793..3713572 within 0


Gene organization within MGE regions


Location: 3687503..3749318
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I0K03_RS18500 (I0K03_18500) - 3688073..3688972 (-) 900 WP_000868234.1 polysaccharide deacetylase family protein -
  I0K03_RS18505 (I0K03_18505) pnp 3689124..3691262 (-) 2139 WP_000076756.1 polyribonucleotide nucleotidyltransferase -
  I0K03_RS18510 (I0K03_18510) rpsO 3691423..3691692 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  I0K03_RS18515 (I0K03_18515) ribF 3691793..3692764 (-) 972 WP_000766713.1 bifunctional riboflavin kinase/FAD synthetase -
  I0K03_RS18520 (I0K03_18520) truB 3692808..3693731 (-) 924 WP_000399360.1 tRNA pseudouridine(55) synthase TruB -
  I0K03_RS18525 (I0K03_18525) rbfA 3693817..3694173 (-) 357 WP_000776439.1 30S ribosome-binding factor RbfA -
  I0K03_RS18530 (I0K03_18530) - 3694189..3694470 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  I0K03_RS18535 (I0K03_18535) infB 3694467..3696527 (-) 2061 WP_000036352.1 translation initiation factor IF-2 -
  I0K03_RS18540 (I0K03_18540) - 3696532..3696843 (-) 312 WP_001286525.1 YlxQ family RNA-binding protein -
  I0K03_RS18545 (I0K03_18545) rnpM 3696844..3697116 (-) 273 WP_000071127.1 RNase P modulator RnpM -
  I0K03_RS18550 (I0K03_18550) nusA 3697128..3698234 (-) 1107 WP_000102596.1 transcription termination factor NusA -
  I0K03_RS18555 (I0K03_18555) rimP 3698252..3698722 (-) 471 WP_000359095.1 ribosome maturation factor RimP -
  I0K03_RS18560 (I0K03_18560) - 3699056..3703357 (-) 4302 WP_198130261.1 PolC-type DNA polymerase III -
  I0K03_RS18565 (I0K03_18565) - 3703482..3705182 (-) 1701 WP_000814296.1 proline--tRNA ligase -
  I0K03_RS18570 (I0K03_18570) rseP 3705292..3706548 (-) 1257 WP_001090232.1 RIP metalloprotease RseP -
  I0K03_RS18575 (I0K03_18575) dxr 3706566..3707708 (-) 1143 WP_000790354.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  I0K03_RS18580 (I0K03_18580) cdsA 3707732..3708523 (-) 792 WP_000813595.1 phosphatidate cytidylyltransferase -
  I0K03_RS18585 (I0K03_18585) uppS 3708541..3709317 (-) 777 WP_000971308.1 isoprenyl transferase -
  I0K03_RS18590 (I0K03_18590) frr 3709403..3709960 (-) 558 WP_000531505.1 ribosome recycling factor -
  I0K03_RS18595 (I0K03_18595) pyrH 3709963..3710685 (-) 723 WP_000042662.1 UMP kinase -
  I0K03_RS18600 (I0K03_18600) tsf 3710752..3711639 (-) 888 WP_001018579.1 translation elongation factor Ts -
  I0K03_RS18605 (I0K03_18605) rpsB 3711743..3712444 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  I0K03_RS18610 (I0K03_18610) codY 3712793..3713572 (-) 780 WP_000421291.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  I0K03_RS18615 (I0K03_18615) hslU 3713650..3715041 (-) 1392 WP_000550076.1 ATP-dependent protease ATPase subunit HslU -
  I0K03_RS18620 (I0K03_18620) hslV 3715064..3715606 (-) 543 WP_000526274.1 ATP-dependent protease proteolytic subunit HslV -
  I0K03_RS18625 (I0K03_18625) xerC 3715649..3716548 (-) 900 WP_001101234.1 tyrosine recombinase XerC -
  I0K03_RS18630 (I0K03_18630) trmFO 3716614..3717918 (-) 1305 WP_000212000.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  I0K03_RS18635 (I0K03_18635) topA 3717967..3720045 (-) 2079 WP_001286959.1 type I DNA topoisomerase -
  I0K03_RS18640 (I0K03_18640) dprA 3720190..3721059 (-) 870 WP_000818053.1 DNA-processing protein DprA -
  I0K03_RS18645 (I0K03_18645) sucD 3721148..3722050 (-) 903 WP_000115185.1 succinate--CoA ligase subunit alpha -
  I0K03_RS18650 (I0K03_18650) sucC 3722070..3723230 (-) 1161 WP_001020779.1 ADP-forming succinate--CoA ligase subunit beta -
  I0K03_RS18655 (I0K03_18655) - 3723425..3724198 (-) 774 WP_001171132.1 ribonuclease HII -
  I0K03_RS18660 (I0K03_18660) ylqF 3724255..3725145 (-) 891 WP_000236689.1 ribosome biogenesis GTPase YlqF -
  I0K03_RS18665 (I0K03_18665) lepB 3725166..3725717 (-) 552 WP_000712442.1 signal peptidase I -
  I0K03_RS18670 (I0K03_18670) rplS 3725819..3726163 (-) 345 WP_001186517.1 50S ribosomal protein L19 -
  I0K03_RS18675 (I0K03_18675) trmD 3726310..3727044 (-) 735 WP_000686906.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  I0K03_RS18680 (I0K03_18680) rimM 3727044..3727559 (-) 516 WP_000170280.1 ribosome maturation factor RimM -
  I0K03_RS18685 (I0K03_18685) - 3727681..3727908 (-) 228 WP_000737399.1 KH domain-containing protein -
  I0K03_RS18690 (I0K03_18690) rpsP 3727923..3728195 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  I0K03_RS18695 (I0K03_18695) ffh 3728297..3729646 (-) 1350 WP_000863463.1 signal recognition particle protein -
  I0K03_RS18700 (I0K03_18700) - 3729659..3729991 (-) 333 WP_000891061.1 putative DNA-binding protein -
  I0K03_RS18705 (I0K03_18705) ftsY 3730125..3731114 (-) 990 WP_198130258.1 signal recognition particle-docking protein FtsY -
  I0K03_RS18710 (I0K03_18710) smc 3731129..3734698 (-) 3570 WP_198130257.1 chromosome segregation protein SMC -
  I0K03_RS18715 (I0K03_18715) rncS 3734850..3735587 (-) 738 WP_001146877.1 ribonuclease III -
  I0K03_RS18720 (I0K03_18720) acpP 3735647..3735880 (-) 234 WP_000786062.1 acyl carrier protein -
  I0K03_RS18725 (I0K03_18725) fabG 3735950..3736690 (-) 741 WP_000911780.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  I0K03_RS18730 (I0K03_18730) fabD 3736690..3737634 (-) 945 WP_000515915.1 ACP S-malonyltransferase -
  I0K03_RS18735 (I0K03_18735) plsX 3737649..3738641 (-) 993 WP_000684090.1 phosphate acyltransferase PlsX -
  I0K03_RS18740 (I0K03_18740) fapR 3738638..3739231 (-) 594 WP_000747351.1 transcription factor FapR -
  I0K03_RS18745 (I0K03_18745) recG 3739320..3741368 (-) 2049 WP_200203333.1 ATP-dependent DNA helicase RecG -
  I0K03_RS18750 (I0K03_18750) - 3741660..3743336 (-) 1677 WP_000027119.1 DAK2 domain-containing protein -
  I0K03_RS18755 (I0K03_18755) - 3743359..3743721 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  I0K03_RS18760 (I0K03_18760) rpmB 3744098..3744286 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  I0K03_RS18765 (I0K03_18765) spoVM 3744360..3744440 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  I0K03_RS18770 (I0K03_18770) - 3744507..3745187 (-) 681 WP_002039429.1 thiamine diphosphokinase -
  I0K03_RS18775 (I0K03_18775) rpe 3745288..3745932 (-) 645 WP_000589965.1 ribulose-phosphate 3-epimerase -
  I0K03_RS18780 (I0K03_18780) rsgA 3745935..3746816 (-) 882 WP_001113944.1 ribosome small subunit-dependent GTPase A -
  I0K03_RS18785 (I0K03_18785) prkC 3747086..3749059 (-) 1974 WP_000904738.1 serine/threonine protein kinase PrkC -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28788.03 Da        Isoelectric Point: 4.7947

>NTDB_id=505553 I0K03_RS18610 WP_000421291.1 3712793..3713572(-) (codY) [Bacillus toyonensis strain P18]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NVTETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=505553 I0K03_RS18610 WP_000421291.1 3712793..3713572(-) (codY) [Bacillus toyonensis strain P18]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAACGAGCGTATGAAACAAATGCTTGCAGAGCGTCAATTCCCAGAAGAATATACGCAAAGCTTATTC
AATGTAACGGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAGAGAATTATTCGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTGTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAATACAGTTCAACTGTAGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCGATTAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCACATTTTCGAAGAGTTAAACGGAACAGAAGGTCTACTTGTTGCAAGTAAAATTGCTGATCGTGTAGGAATCACTC
GTTCTGTGATTGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTAATCGAGTCTCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTTTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1V6LJD3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.853

100

0.819
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.275

98.456

0.456