Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   BACVE_RS16695 Genome accession   NZ_CP063687
Coordinates   3268540..3268806 (+) Length   88 a.a.
NCBI ID   WP_050496152.1    Uniprot ID   -
Organism   Bacillus velezensis strain NST6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3263540..3273806
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BACVE_RS16675 (BACVE_003362) - 3263809..3265110 (-) 1302 WP_025649848.1 hemolysin family protein -
  BACVE_RS16680 (BACVE_003363) - 3265256..3266206 (+) 951 WP_014418379.1 magnesium transporter CorA family protein -
  BACVE_RS16685 (BACVE_003364) comGA 3266399..3267469 (+) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  BACVE_RS16690 (BACVE_003365) comGB 3267456..3268493 (+) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  BACVE_RS16695 (BACVE_003366) comGC 3268540..3268806 (+) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  BACVE_RS16700 (BACVE_003367) comGD 3268796..3269233 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  BACVE_RS16705 (BACVE_003368) comGE 3269217..3269531 (+) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  BACVE_RS16710 (BACVE_003369) comGF 3269545..3269940 (+) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  BACVE_RS16715 (BACVE_003370) comGG 3269941..3270318 (+) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  BACVE_RS16720 (BACVE_003371) - 3270375..3270554 (+) 180 WP_003153093.1 YqzE family protein -
  BACVE_RS16725 (BACVE_003372) - 3270595..3270924 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BACVE_RS16730 (BACVE_003373) tapA 3271183..3271854 (+) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  BACVE_RS16735 (BACVE_003374) - 3271826..3272410 (+) 585 WP_014418370.1 signal peptidase I -
  BACVE_RS16740 (BACVE_003375) - 3272475..3273260 (+) 786 WP_017418136.1 TasA family protein -
  BACVE_RS16745 (BACVE_003376) sinR 3273308..3273643 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9740.36 Da        Isoelectric Point: 6.4456

>NTDB_id=496308 BACVE_RS16695 WP_050496152.1 3268540..3268806(+) (comGC) [Bacillus velezensis strain NST6]
MLIVLFIVSILLLITIPNVTKHNQSIQRKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=496308 BACVE_RS16695 WP_050496152.1 3268540..3268806(+) (comGC) [Bacillus velezensis strain NST6]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCGTAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

73.611

81.818

0.602