Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   KHA81_RS12005 Genome accession   NZ_CP074391
Coordinates   2493402..2493668 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain L-17     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2488402..2498668
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHA81_RS11955 sinR 2488566..2488901 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KHA81_RS11960 tasA 2488949..2489734 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  KHA81_RS11965 sipW 2489798..2490382 (-) 585 WP_012117977.1 signal peptidase I SipW -
  KHA81_RS11970 tapA 2490354..2491025 (-) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  KHA81_RS11975 - 2491285..2491614 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KHA81_RS11980 - 2491654..2491833 (-) 180 WP_003153093.1 YqzE family protein -
  KHA81_RS11985 comGG 2491890..2492267 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  KHA81_RS11990 comGF 2492268..2492768 (-) 501 WP_225879914.1 competence type IV pilus minor pilin ComGF Machinery gene
  KHA81_RS11995 comGE 2492677..2492991 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  KHA81_RS12000 comGD 2492975..2493412 (-) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene
  KHA81_RS12005 comGC 2493402..2493668 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  KHA81_RS12010 comGB 2493715..2494752 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  KHA81_RS12015 comGA 2494739..2495809 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  KHA81_RS12020 - 2496001..2496951 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -
  KHA81_RS12025 - 2497097..2498398 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=491214 KHA81_RS12005 WP_042635730.1 2493402..2493668(-) (comGC) [Bacillus amyloliquefaciens strain L-17]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=491214 KHA81_RS12005 WP_042635730.1 2493402..2493668(-) (comGC) [Bacillus amyloliquefaciens strain L-17]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602