Detailed information    

insolico Bioinformatically predicted

Overview

Name   comF   Type   Machinery gene
Locus tag   IAQ69_RS13375 Genome accession   NZ_CP060811
Coordinates   2787200..2787634 (-) Length   144 a.a.
NCBI ID   WP_180033761.1    Uniprot ID   -
Organism   Acinetobacter variabilis strain XM9F202-2     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 2786800..2811100 2787200..2787634 within 0


Gene organization within MGE regions


Location: 2786800..2811100
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IAQ69_RS13370 (IAQ69_13365) rpsP 2786800..2787057 (-) 258 WP_004826436.1 30S ribosomal protein S16 -
  IAQ69_RS13375 (IAQ69_13370) comF 2787200..2787634 (-) 435 WP_180033761.1 type IV pilin protein Machinery gene
  IAQ69_RS13380 (IAQ69_13375) - 2787634..2788182 (-) 549 WP_180033759.1 type IV pilin protein -
  IAQ69_RS13385 (IAQ69_13380) - 2788184..2791804 (-) 3621 WP_200229134.1 PilC/PilY family type IV pilus protein -
  IAQ69_RS13390 (IAQ69_13385) - 2791821..2792537 (-) 717 WP_413785356.1 pilus assembly protein PilX -
  IAQ69_RS13395 (IAQ69_13390) - 2792534..2793616 (-) 1083 WP_200229136.1 PilW family protein -
  IAQ69_RS13400 (IAQ69_13395) pilV 2793609..2794112 (-) 504 WP_180160774.1 type IV pilus modification protein PilV -
  IAQ69_RS13405 (IAQ69_13400) - 2794125..2794541 (-) 417 WP_227607406.1 Tfp pilus assembly protein FimT/FimU -
  IAQ69_RS13410 (IAQ69_13405) ispH 2794705..2795655 (-) 951 WP_180033753.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
  IAQ69_RS13415 (IAQ69_13410) gmk 2795791..2796414 (+) 624 WP_004787090.1 guanylate kinase -
  IAQ69_RS13420 (IAQ69_13415) rpoZ 2796492..2796773 (+) 282 WP_004650579.1 DNA-directed RNA polymerase subunit omega -
  IAQ69_RS13425 (IAQ69_13420) - 2796991..2799096 (+) 2106 WP_004787093.1 RelA/SpoT family protein -
  IAQ69_RS13430 (IAQ69_13425) - 2799170..2800228 (-) 1059 WP_180033751.1 RNA-guided endonuclease InsQ/TnpB family protein -
  IAQ69_RS13435 (IAQ69_13430) - 2800360..2800743 (+) 384 WP_004787096.1 RidA family protein -
  IAQ69_RS13440 (IAQ69_13435) - 2800962..2801156 (+) 195 WP_004787097.1 bacterioferritin-associated ferredoxin -
  IAQ69_RS13445 (IAQ69_13440) bfr 2801383..2801847 (+) 465 WP_034705394.1 heteropolymeric bacterioferritin subunit Bfr -
  IAQ69_RS13450 (IAQ69_13445) - 2801902..2803536 (-) 1635 WP_200229138.1 PglL family O-oligosaccharyltransferase -
  IAQ69_RS16965 - 2803623..2803757 (-) 135 WP_265092712.1 hypothetical protein -
  IAQ69_RS13455 (IAQ69_13450) - 2803754..2804359 (-) 606 WP_227607408.1 type4 fimbrial accessory protein -
  IAQ69_RS13460 (IAQ69_13455) - 2804424..2804867 (-) 444 WP_200229142.1 pilin -
  IAQ69_RS13465 (IAQ69_13460) - 2805646..2806152 (+) 507 WP_200229144.1 pilin -
  IAQ69_RS13470 (IAQ69_13465) - 2806227..2806481 (+) 255 WP_200229146.1 hypothetical protein -
  IAQ69_RS13475 (IAQ69_13470) tfpZ 2806500..2807234 (+) 735 WP_200229148.1 TfpX/TfpZ family type IV pilin accessory protein -
  IAQ69_RS13480 (IAQ69_13475) - 2807306..2807617 (-) 312 WP_200230878.1 hypothetical protein -
  IAQ69_RS13485 (IAQ69_13480) - 2807682..2808242 (-) 561 WP_200229156.1 TPM domain-containing protein -
  IAQ69_RS13490 (IAQ69_13485) - 2808236..2809279 (-) 1044 WP_200229158.1 TPM domain-containing protein -
  IAQ69_RS13495 (IAQ69_13490) - 2809317..2809910 (-) 594 WP_004787108.1 LemA family protein -
  IAQ69_RS13500 (IAQ69_13495) - 2810138..2811100 (-) 963 WP_180070468.1 IS30-like element IS18 family transposase -

Sequence

Protein


Download         Length: 144 a.a.        Molecular weight: 16224.50 Da        Isoelectric Point: 9.1904

>NTDB_id=478544 IAQ69_RS13375 WP_180033761.1 2787200..2787634(-) (comF) [Acinetobacter variabilis strain XM9F202-2]
MNKTKGFTLIELMIAVAIIGILAAIAYPSYIEYVKRTNRIDMQTQLLMIMHKLQNYKVINHTYKNASLSNLKVDSTYPST
GLYDVELSVDSDGQGYLLKASPSAGKSQKNDGDLCINQEGYRYWRKANTCDRSNLTATSNWDGR

Nucleotide


Download         Length: 435 bp        

>NTDB_id=478544 IAQ69_RS13375 WP_180033761.1 2787200..2787634(-) (comF) [Acinetobacter variabilis strain XM9F202-2]
ATGAATAAAACAAAAGGATTTACACTGATTGAATTAATGATTGCTGTGGCAATCATTGGGATCTTGGCTGCAATTGCATA
TCCTTCTTATATTGAGTATGTTAAACGTACAAATCGTATAGATATGCAAACTCAATTGTTAATGATTATGCATAAGTTGC
AAAATTATAAAGTTATAAATCATACCTATAAAAATGCAAGTTTATCTAATTTGAAGGTTGATTCAACTTATCCATCAACA
GGATTATATGATGTCGAATTATCAGTCGATTCTGATGGGCAAGGGTATTTATTAAAAGCTTCACCTAGTGCAGGTAAAAG
TCAAAAGAATGATGGTGACTTGTGTATAAATCAAGAAGGTTATCGTTATTGGAGAAAAGCGAATACCTGTGATAGAAGTA
ATTTAACTGCCACATCAAACTGGGACGGACGCTAA

Domains

Predicted by InterproScan.

Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS)

(28-115)

Prokaryotic N-terminal methylation motif (N_methyl)

(1-27)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comF Acinetobacter baylyi ADP1

52.055

100

0.528
  pilE Acinetobacter baumannii D1279779

39.286

97.222

0.382