Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   H0242_RS19595 Genome accession   NZ_CP059148
Coordinates   3863468..3864247 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus thuringiensis serovar sumiyoshiensis strain 4AO1     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3832096..3899912 3863468..3864247 within 0


Gene organization within MGE regions


Location: 3832096..3899912
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0242_RS19455 (H0242_19210) dapG 3832902..3834134 (-) 1233 WP_061666405.1 aspartate kinase -
  H0242_RS19460 (H0242_19215) asd 3834158..3835204 (-) 1047 Protein_3775 aspartate-semialdehyde dehydrogenase -
  H0242_RS19465 (H0242_19220) dpaB 3835355..3835954 (-) 600 WP_000053596.1 dipicolinate synthase subunit B -
  H0242_RS19470 (H0242_19225) dpaA 3835951..3836853 (-) 903 WP_000954735.1 dipicolinic acid synthetase subunit A -
  H0242_RS19475 (H0242_19230) - 3837024..3837275 (-) 252 WP_001239759.1 YlmC/YmxH family sporulation protein -
  H0242_RS19480 (H0242_19235) - 3837411..3838652 (-) 1242 WP_000592988.1 M16 family metallopeptidase -
  H0242_RS19485 (H0242_19240) - 3838740..3839639 (-) 900 WP_000868223.1 polysaccharide deacetylase family protein -
  H0242_RS19490 (H0242_19245) pnp 3839792..3841930 (-) 2139 WP_000076753.1 polyribonucleotide nucleotidyltransferase -
  H0242_RS19495 (H0242_19250) rpsO 3842091..3842360 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  H0242_RS19500 (H0242_19255) ribF 3842461..3843432 (-) 972 WP_086407615.1 bifunctional riboflavin kinase/FAD synthetase -
  H0242_RS19505 (H0242_19260) truB 3843476..3844399 (-) 924 WP_000399366.1 tRNA pseudouridine(55) synthase TruB -
  H0242_RS19510 (H0242_19265) rbfA 3844486..3844842 (-) 357 WP_000776437.1 30S ribosome-binding factor RbfA -
  H0242_RS19515 (H0242_19270) - 3844858..3845139 (-) 282 WP_000634349.1 DUF503 domain-containing protein -
  H0242_RS19520 (H0242_19275) infB 3845136..3847202 (-) 2067 WP_000036346.1 translation initiation factor IF-2 -
  H0242_RS19525 (H0242_19280) - 3847207..3847518 (-) 312 WP_001286522.1 YlxQ family RNA-binding protein -
  H0242_RS19530 (H0242_19285) rnpM 3847519..3847791 (-) 273 WP_000071123.1 RNase P modulator RnpM -
  H0242_RS19535 (H0242_19290) nusA 3847803..3848909 (-) 1107 WP_000102598.1 transcription termination factor NusA -
  H0242_RS19540 (H0242_19295) rimP 3848927..3849397 (-) 471 WP_000359095.1 ribosome maturation factor RimP -
  H0242_RS19545 (H0242_19300) - 3849731..3854032 (-) 4302 WP_000059996.1 PolC-type DNA polymerase III -
  H0242_RS19550 (H0242_19305) - 3854157..3855857 (-) 1701 WP_086407616.1 proline--tRNA ligase -
  H0242_RS19555 (H0242_19310) rseP 3855967..3857223 (-) 1257 WP_001090242.1 RIP metalloprotease RseP -
  H0242_RS19560 (H0242_19315) dxr 3857241..3858383 (-) 1143 WP_000790358.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  H0242_RS19565 (H0242_19320) cdsA 3858407..3859198 (-) 792 WP_000813589.1 phosphatidate cytidylyltransferase -
  H0242_RS19570 (H0242_19325) uppS 3859216..3859992 (-) 777 WP_000971296.1 isoprenyl transferase -
  H0242_RS19575 (H0242_19330) frr 3860078..3860635 (-) 558 WP_000531505.1 ribosome recycling factor -
  H0242_RS19580 (H0242_19335) pyrH 3860638..3861360 (-) 723 WP_000042669.1 UMP kinase -
  H0242_RS19585 (H0242_19340) tsf 3861427..3862314 (-) 888 WP_001018575.1 translation elongation factor Ts -
  H0242_RS19590 (H0242_19345) rpsB 3862418..3863119 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  H0242_RS19595 (H0242_19350) codY 3863468..3864247 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  H0242_RS19600 (H0242_19355) hslU 3864325..3865716 (-) 1392 WP_000550084.1 ATP-dependent protease ATPase subunit HslU -
  H0242_RS19605 (H0242_19360) hslV 3865739..3866281 (-) 543 WP_000526274.1 ATP-dependent protease proteolytic subunit HslV -
  H0242_RS19610 (H0242_19365) xerC 3866324..3867223 (-) 900 WP_001101245.1 tyrosine recombinase XerC -
  H0242_RS19615 (H0242_19370) trmFO 3867289..3868593 (-) 1305 WP_000213006.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  H0242_RS19620 (H0242_19375) topA 3868642..3870720 (-) 2079 WP_001286957.1 type I DNA topoisomerase -
  H0242_RS19625 (H0242_19380) dprA 3870865..3871734 (-) 870 WP_000818045.1 DNA-processing protein DprA -
  H0242_RS19630 (H0242_19385) sucD 3871823..3872725 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  H0242_RS19635 (H0242_19390) sucC 3872745..3873905 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  H0242_RS19640 (H0242_19395) - 3874099..3874872 (-) 774 WP_001171121.1 ribonuclease HII -
  H0242_RS19645 (H0242_19400) ylqF 3874929..3875819 (-) 891 WP_000236702.1 ribosome biogenesis GTPase YlqF -
  H0242_RS19650 (H0242_19405) lepB 3875840..3876391 (-) 552 WP_000711853.1 signal peptidase I -
  H0242_RS19655 (H0242_19410) rplS 3876493..3876837 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  H0242_RS19660 (H0242_19415) trmD 3876984..3877718 (-) 735 WP_086407617.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  H0242_RS19665 (H0242_19420) rimM 3877718..3878233 (-) 516 WP_000170273.1 ribosome maturation factor RimM -
  H0242_RS19670 (H0242_19425) - 3878354..3878581 (-) 228 WP_000737393.1 KH domain-containing protein -
  H0242_RS19675 (H0242_19430) rpsP 3878596..3878868 (-) 273 WP_000268748.1 30S ribosomal protein S16 -
  H0242_RS19680 (H0242_19435) ffh 3878970..3880319 (-) 1350 WP_000863460.1 signal recognition particle protein -
  H0242_RS19685 (H0242_19440) - 3880332..3880664 (-) 333 WP_000891062.1 putative DNA-binding protein -
  H0242_RS19690 (H0242_19445) ftsY 3880797..3881786 (-) 990 WP_000007641.1 signal recognition particle-docking protein FtsY -
  H0242_RS19695 (H0242_19450) smc 3881802..3885371 (-) 3570 WP_086407618.1 chromosome segregation protein SMC -
  H0242_RS19700 (H0242_19455) rncS 3885519..3886256 (-) 738 WP_001146875.1 ribonuclease III -
  H0242_RS19705 (H0242_19460) acpP 3886315..3886548 (-) 234 WP_000786062.1 acyl carrier protein -
  H0242_RS19710 (H0242_19465) fabG 3886618..3887358 (-) 741 WP_000911774.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  H0242_RS19715 (H0242_19470) fabD 3887358..3888302 (-) 945 WP_000515897.1 ACP S-malonyltransferase -
  H0242_RS19720 (H0242_19475) plsX 3888317..3889309 (-) 993 WP_000684095.1 phosphate acyltransferase PlsX -
  H0242_RS19725 (H0242_19480) fapR 3889306..3889899 (-) 594 WP_000747349.1 transcription factor FapR -
  H0242_RS19730 (H0242_19485) recG 3889987..3892035 (-) 2049 WP_001000825.1 ATP-dependent DNA helicase RecG -
  H0242_RS19735 (H0242_19490) - 3892326..3894002 (-) 1677 WP_086407619.1 DAK2 domain-containing protein -
  H0242_RS19740 (H0242_19495) - 3894025..3894387 (-) 363 WP_000021110.1 Asp23/Gls24 family envelope stress response protein -
  H0242_RS19745 (H0242_19500) rpmB 3894764..3894952 (+) 189 WP_086407620.1 50S ribosomal protein L28 -
  H0242_RS19750 (H0242_19505) spoVM 3895025..3895105 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  H0242_RS19755 (H0242_19510) - 3895172..3895852 (-) 681 WP_000752664.1 thiamine diphosphokinase -
  H0242_RS19760 (H0242_19515) rpe 3895922..3896566 (-) 645 WP_000589974.1 ribulose-phosphate 3-epimerase -
  H0242_RS19765 (H0242_19520) rsgA 3896569..3897450 (-) 882 WP_001113931.1 ribosome small subunit-dependent GTPase A -
  H0242_RS19770 (H0242_19525) pknB 3897697..3899670 (-) 1974 WP_086407621.1 Stk1 family PASTA domain-containing Ser/Thr kinase -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=467374 H0242_RS19595 WP_000421290.1 3863468..3864247(-) (codY) [Bacillus thuringiensis serovar sumiyoshiensis strain 4AO1]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=467374 H0242_RS19595 WP_000421290.1 3863468..3864247(-) (codY) [Bacillus thuringiensis serovar sumiyoshiensis strain 4AO1]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGTGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTAGGTCAAG
AGTTCTTAGATGACGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCACATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GCTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGCTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAGGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459