Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   HWH77_RS02745 Genome accession   NZ_CP058216
Coordinates   586088..586354 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain LF01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 581088..591354
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWH77_RS02695 (HWH77_02700) sinR 581253..581588 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HWH77_RS02700 (HWH77_02705) tasA 581636..582421 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  HWH77_RS02705 (HWH77_02710) sipW 582485..583069 (-) 585 WP_003153100.1 signal peptidase I SipW -
  HWH77_RS02710 (HWH77_02715) tapA 583041..583712 (-) 672 WP_046341384.1 amyloid fiber anchoring/assembly protein TapA -
  HWH77_RS02715 (HWH77_02720) - 583971..584300 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  HWH77_RS02720 (HWH77_02725) - 584340..584519 (-) 180 WP_003153093.1 YqzE family protein -
  HWH77_RS02725 (HWH77_02730) comGG 584576..584953 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  HWH77_RS02730 (HWH77_02735) comGF 584954..585349 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  HWH77_RS02735 (HWH77_02740) comGE 585363..585677 (-) 315 WP_046341385.1 competence type IV pilus minor pilin ComGE -
  HWH77_RS02740 (HWH77_02745) comGD 585661..586098 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  HWH77_RS02745 (HWH77_02750) comGC 586088..586354 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  HWH77_RS02750 (HWH77_02755) comGB 586401..587438 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  HWH77_RS02755 (HWH77_02760) comGA 587425..588495 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  HWH77_RS02760 (HWH77_02765) - 588687..589637 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -
  HWH77_RS02765 (HWH77_02770) - 589783..591084 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=462680 HWH77_RS02745 WP_042635730.1 586088..586354(-) (comGC) [Bacillus velezensis strain LF01]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=462680 HWH77_RS02745 WP_042635730.1 586088..586354(-) (comGC) [Bacillus velezensis strain LF01]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602