Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   FOC75_RS16885 Genome accession   NZ_CP053991
Coordinates   3209587..3210366 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus cereus strain FDAARGOS_781     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3175265..3249190 3209587..3210366 within 0


Gene organization within MGE regions


Location: 3175265..3249190
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FOC75_RS16735 (FOC75_16735) - 3175608..3177278 (-) 1671 WP_000823085.1 ribonuclease J -
  FOC75_RS16740 (FOC75_16740) dapA 3178044..3178922 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  FOC75_RS16745 (FOC75_16745) dapG 3178934..3180166 (-) 1233 WP_000692470.1 aspartate kinase -
  FOC75_RS16750 (FOC75_16750) asd 3180190..3181236 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  FOC75_RS16755 (FOC75_16755) dpaB 3181387..3181986 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  FOC75_RS16760 (FOC75_16760) dpaA 3181983..3182885 (-) 903 WP_000954728.1 dipicolinic acid synthetase subunit A -
  FOC75_RS16765 (FOC75_16765) - 3183160..3183411 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  FOC75_RS16770 (FOC75_16770) - 3183538..3184779 (-) 1242 WP_000592985.1 pitrilysin family protein -
  FOC75_RS16775 (FOC75_16775) - 3184866..3185765 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  FOC75_RS16780 (FOC75_16780) pnp 3185917..3188055 (-) 2139 WP_000076750.1 polyribonucleotide nucleotidyltransferase -
  FOC75_RS16785 (FOC75_16785) rpsO 3188216..3188485 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  FOC75_RS16790 (FOC75_16790) ribF 3188586..3189557 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  FOC75_RS16795 (FOC75_16795) truB 3189601..3190524 (-) 924 WP_000399337.1 tRNA pseudouridine(55) synthase TruB -
  FOC75_RS16800 (FOC75_16800) rbfA 3190611..3190967 (-) 357 WP_000776441.1 30S ribosome-binding factor RbfA -
  FOC75_RS16805 (FOC75_16805) - 3190983..3191264 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  FOC75_RS16810 (FOC75_16810) infB 3191261..3193321 (-) 2061 WP_000036341.1 translation initiation factor IF-2 -
  FOC75_RS16815 (FOC75_16815) - 3193326..3193637 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  FOC75_RS16820 (FOC75_16820) - 3193638..3193910 (-) 273 WP_000071128.1 YlxR family protein -
  FOC75_RS16825 (FOC75_16825) nusA 3193922..3195028 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  FOC75_RS16830 (FOC75_16830) rimP 3195046..3195516 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  FOC75_RS16835 (FOC75_16835) - 3195849..3200150 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  FOC75_RS16840 (FOC75_16840) - 3200275..3201975 (-) 1701 WP_000814312.1 proline--tRNA ligase -
  FOC75_RS16845 (FOC75_16845) rseP 3202085..3203341 (-) 1257 WP_001090229.1 RIP metalloprotease RseP -
  FOC75_RS16850 (FOC75_16850) dxr 3203358..3204500 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  FOC75_RS16855 (FOC75_16855) cdsA 3204524..3205315 (-) 792 WP_000813581.1 phosphatidate cytidylyltransferase -
  FOC75_RS16860 (FOC75_16860) uppS 3205333..3206109 (-) 777 WP_000971301.1 isoprenyl transferase -
  FOC75_RS16865 (FOC75_16865) frr 3206195..3206752 (-) 558 WP_000531503.1 ribosome recycling factor -
  FOC75_RS16870 (FOC75_16870) pyrH 3206755..3207477 (-) 723 WP_000042663.1 UMP kinase -
  FOC75_RS16875 (FOC75_16875) tsf 3207544..3208431 (-) 888 WP_001018581.1 translation elongation factor Ts -
  FOC75_RS16880 (FOC75_16880) rpsB 3208535..3209236 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  FOC75_RS16885 (FOC75_16885) codY 3209587..3210366 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  FOC75_RS16890 (FOC75_16890) hslU 3210444..3211835 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  FOC75_RS16895 (FOC75_16895) hslV 3211858..3212400 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  FOC75_RS16900 (FOC75_16900) xerC 3212443..3213342 (-) 900 WP_001101227.1 tyrosine recombinase XerC -
  FOC75_RS16905 (FOC75_16905) trmFO 3213408..3214712 (-) 1305 WP_001991958.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  FOC75_RS16910 (FOC75_16910) topA 3214763..3216841 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  FOC75_RS16915 (FOC75_16915) dprA 3216986..3217855 (-) 870 WP_000818033.1 DNA-processing protein DprA -
  FOC75_RS16920 (FOC75_16920) sucD 3217943..3218845 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  FOC75_RS16925 (FOC75_16925) sucC 3218865..3220025 (-) 1161 WP_001020785.1 ADP-forming succinate--CoA ligase subunit beta -
  FOC75_RS16930 (FOC75_16930) rnhB 3220219..3220992 (-) 774 WP_001174714.1 ribonuclease HII -
  FOC75_RS16935 (FOC75_16935) ylqF 3221044..3221934 (-) 891 WP_000236696.1 ribosome biogenesis GTPase YlqF -
  FOC75_RS16940 (FOC75_16940) lepB 3221955..3222506 (-) 552 WP_000711857.1 signal peptidase I -
  FOC75_RS16945 (FOC75_16945) rplS 3222608..3222952 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  FOC75_RS16950 (FOC75_16950) trmD 3223099..3223833 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  FOC75_RS16955 (FOC75_16955) rimM 3223833..3224348 (-) 516 WP_000170268.1 ribosome maturation factor RimM -
  FOC75_RS16960 (FOC75_16960) - 3224469..3224696 (-) 228 WP_000737398.1 KH domain-containing protein -
  FOC75_RS16965 (FOC75_16965) rpsP 3224711..3224983 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  FOC75_RS16970 (FOC75_16970) ffh 3225084..3226433 (-) 1350 WP_000863461.1 signal recognition particle protein -
  FOC75_RS16975 (FOC75_16975) - 3226446..3226778 (-) 333 WP_000891062.1 putative DNA-binding protein -
  FOC75_RS16980 (FOC75_16980) ftsY 3226912..3227901 (-) 990 WP_000007651.1 signal recognition particle-docking protein FtsY -
  FOC75_RS16985 (FOC75_16985) smc 3227917..3231486 (-) 3570 WP_000478986.1 chromosome segregation protein SMC -
  FOC75_RS16990 (FOC75_16990) rncS 3231633..3232370 (-) 738 WP_001146873.1 ribonuclease III -
  FOC75_RS16995 (FOC75_16995) acpP 3232429..3232662 (-) 234 WP_000786062.1 acyl carrier protein -
  FOC75_RS17000 (FOC75_17000) fabG 3232732..3233472 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  FOC75_RS17005 (FOC75_17005) fabD 3233472..3234416 (-) 945 WP_000516948.1 ACP S-malonyltransferase -
  FOC75_RS17010 (FOC75_17010) plsX 3234431..3235423 (-) 993 WP_000684108.1 phosphate acyltransferase PlsX -
  FOC75_RS17015 (FOC75_17015) fapR 3235420..3236013 (-) 594 WP_000747352.1 transcription factor FapR -
  FOC75_RS17020 (FOC75_17020) recG 3236102..3238150 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  FOC75_RS17025 (FOC75_17025) - 3238440..3240116 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  FOC75_RS17030 (FOC75_17030) - 3240139..3240501 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  FOC75_RS17035 (FOC75_17035) rpmB 3240880..3241068 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  FOC75_RS17040 (FOC75_17040) spoVM 3241142..3241222 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  FOC75_RS17045 (FOC75_17045) - 3241289..3241969 (-) 681 WP_033688055.1 thiamine diphosphokinase -
  FOC75_RS17050 (FOC75_17050) rpe 3242069..3242713 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  FOC75_RS17055 (FOC75_17055) rsgA 3242716..3243597 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  FOC75_RS17060 (FOC75_17060) prkC 3243866..3245839 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  FOC75_RS17065 (FOC75_17065) - 3245848..3246600 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  FOC75_RS17070 (FOC75_17070) rlmN 3246605..3247693 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  FOC75_RS17075 (FOC75_17075) rsmB 3247698..3249032 (-) 1335 WP_001249652.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=449838 FOC75_RS16885 WP_000421288.1 3209587..3210366(-) (codY) [Bacillus cereus strain FDAARGOS_781]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=449838 FOC75_RS16885 WP_000421288.1 3209587..3210366(-) (codY) [Bacillus cereus strain FDAARGOS_781]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459