Detailed information    

insolico Bioinformatically predicted

Overview


Name   codY   Type   Regulator
Locus tag   FOC92_RS07480 Genome accession   NZ_CP053954
Coordinates   852346..853125 (-) Length   259 a.a.
NCBI ID   WP_000421290.1    Uniprot ID   A0A9W5VKA1
Organism   Bacillus cereus strain FDAARGOS_798     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 836899..891965 852346..853125 within 0


Gene organization within MGE regions


Location: 836899..891965
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FOC92_RS07425 (FOC92_07430) rimP 837801..838271 (-) 471 WP_000359096.1 ribosome maturation factor RimP -
  FOC92_RS07430 (FOC92_07435) - 838608..842909 (-) 4302 WP_172852545.1 PolC-type DNA polymerase III -
  FOC92_RS07435 (FOC92_07440) - 843034..844734 (-) 1701 WP_000814333.1 proline--tRNA ligase -
  FOC92_RS07440 (FOC92_07445) rseP 844844..846100 (-) 1257 WP_001090245.1 RIP metalloprotease RseP -
  FOC92_RS07445 (FOC92_07450) dxr 846118..847260 (-) 1143 WP_000790372.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  FOC92_RS07450 (FOC92_07455) cdsA 847284..848075 (-) 792 WP_000813592.1 phosphatidate cytidylyltransferase -
  FOC92_RS07455 (FOC92_07460) uppS 848093..848869 (-) 777 WP_000971296.1 isoprenyl transferase -
  FOC92_RS07460 (FOC92_07465) frr 848955..849512 (-) 558 WP_000531501.1 ribosome recycling factor -
  FOC92_RS07465 (FOC92_07470) pyrH 849515..850237 (-) 723 WP_000042668.1 UMP kinase -
  FOC92_RS07470 (FOC92_07475) tsf 850304..851191 (-) 888 WP_001018578.1 translation elongation factor Ts -
  FOC92_RS07475 (FOC92_07480) rpsB 851295..851996 (-) 702 WP_000111485.1 30S ribosomal protein S2 -
  FOC92_RS07480 (FOC92_07485) codY 852346..853125 (-) 780 WP_000421290.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  FOC92_RS07485 (FOC92_07490) hslU 853203..854594 (-) 1392 WP_000550087.1 ATP-dependent protease ATPase subunit HslU -
  FOC92_RS07490 (FOC92_07495) hslV 854617..855159 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  FOC92_RS07495 (FOC92_07500) xerC 855202..856101 (-) 900 WP_001101241.1 tyrosine recombinase XerC -
  FOC92_RS07500 (FOC92_07505) trmFO 856167..857471 (-) 1305 WP_000213002.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  FOC92_RS07505 (FOC92_07510) topA 857520..859598 (-) 2079 WP_172852546.1 type I DNA topoisomerase -
  FOC92_RS07510 (FOC92_07515) dprA 859743..860612 (-) 870 WP_000818039.1 DNA-processing protein DprA -
  FOC92_RS07515 (FOC92_07520) sucD 860700..861602 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  FOC92_RS07520 (FOC92_07525) sucC 861622..862782 (-) 1161 WP_001020791.1 ADP-forming succinate--CoA ligase subunit beta -
  FOC92_RS07525 (FOC92_07530) - 862977..863750 (-) 774 WP_001193513.1 ribonuclease HII -
  FOC92_RS07530 (FOC92_07535) ylqF 863807..864697 (-) 891 WP_000236702.1 ribosome biogenesis GTPase YlqF -
  FOC92_RS07535 (FOC92_07540) lepB 864718..865269 (-) 552 WP_000711851.1 signal peptidase I -
  FOC92_RS07540 (FOC92_07545) rplS 865371..865715 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  FOC92_RS07545 (FOC92_07550) trmD 865862..866596 (-) 735 WP_000686903.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  FOC92_RS07550 (FOC92_07555) rimM 866596..867111 (-) 516 WP_000170278.1 ribosome maturation factor RimM -
  FOC92_RS07555 (FOC92_07560) - 867232..867459 (-) 228 WP_000737401.1 KH domain-containing protein -
  FOC92_RS07560 (FOC92_07565) rpsP 867474..867746 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  FOC92_RS07565 (FOC92_07570) ffh 867848..869197 (-) 1350 WP_000863460.1 signal recognition particle protein -
  FOC92_RS07570 (FOC92_07575) - 869210..869542 (-) 333 WP_000891062.1 putative DNA-binding protein -
  FOC92_RS07575 (FOC92_07580) ftsY 869676..870665 (-) 990 WP_000007655.1 signal recognition particle-docking protein FtsY -
  FOC92_RS07580 (FOC92_07585) smc 870681..874250 (-) 3570 WP_172852547.1 chromosome segregation protein SMC -
  FOC92_RS07585 (FOC92_07590) rncS 874397..875134 (-) 738 WP_001146875.1 ribonuclease III -
  FOC92_RS07590 (FOC92_07595) acpP 875193..875426 (-) 234 WP_000786062.1 acyl carrier protein -
  FOC92_RS07595 (FOC92_07600) fabG 875496..876236 (-) 741 WP_000911768.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  FOC92_RS07600 (FOC92_07605) fabD 876236..877180 (-) 945 WP_000515903.1 ACP S-malonyltransferase -
  FOC92_RS07605 (FOC92_07610) plsX 877195..878187 (-) 993 WP_000684098.1 phosphate acyltransferase PlsX -
  FOC92_RS07610 (FOC92_07615) fapR 878184..878777 (-) 594 WP_000747349.1 transcription factor FapR -
  FOC92_RS07615 (FOC92_07620) recG 878866..880914 (-) 2049 WP_001000813.1 ATP-dependent DNA helicase RecG -
  FOC92_RS07620 (FOC92_07625) - 881205..882881 (-) 1677 WP_000027129.1 DAK2 domain-containing protein -
  FOC92_RS07625 (FOC92_07630) - 882904..883266 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  FOC92_RS07630 (FOC92_07635) rpmB 883643..883831 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  FOC92_RS07635 (FOC92_07640) spoVM 883905..883985 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  FOC92_RS07640 (FOC92_07645) - 884052..884732 (-) 681 WP_002062149.1 thiamine diphosphokinase -
  FOC92_RS07645 (FOC92_07650) rpe 884802..885446 (-) 645 WP_000589974.1 ribulose-phosphate 3-epimerase -
  FOC92_RS07650 (FOC92_07655) rsgA 885449..886330 (-) 882 WP_001113932.1 ribosome small subunit-dependent GTPase A -
  FOC92_RS07655 (FOC92_07660) pknB 886577..888550 (-) 1974 WP_000904748.1 Stk1 family PASTA domain-containing Ser/Thr kinase -
  FOC92_RS07660 (FOC92_07665) - 888559..889311 (-) 753 WP_000648703.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  FOC92_RS07665 (FOC92_07670) rlmN 889316..890404 (-) 1089 WP_000450541.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  FOC92_RS07670 (FOC92_07675) rsmB 890409..891743 (-) 1335 WP_001249668.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence


Protein


Download         Length: 259 a.a.        Molecular weight: 28793.05 Da        Isoelectric Point: 4.7165

>NTDB_id=449369 FOC92_RS07480 WP_000421290.1 852346..853125(-) (codY) [Bacillus cereus strain FDAARGOS_798]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENRELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLQELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=449369 FOC92_RS07480 WP_000421290.1 852346..853125(-) (codY) [Bacillus cereus strain FDAARGOS_798]
ATGGAATTATTAGCAAAAACGAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGGAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCAAACGTATTCGTAGTTAGCCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAAAACGAACGCATGAAGCAAATGCTTGCAGAACGTCAATTCCCAGAAGAATATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTGAACAGTGCTTACACAGCATTCCCAGTAGAAAACAGAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCAATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTATTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATCCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATCTTACGTGAAAAAGCAGAA
GAAATCGAAGAGGAAGCACGTAGTAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAGTTAGAAGCAAT
TGAGCACATCTTCGAAGAATTAAATGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGATCGCGTAGGAATTACTC
GTTCTGTAATCGTAAATGCACTACGTAAATTAGAAAGTGCTGGTGTTATTGAGTCTCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTGCTAAACGACAAGTTTCTACAGGAACTTGCTAAATTAAAAACAAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.467

100

0.815

  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459