Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   FOC86_RS15160 Genome accession   NZ_CP053938
Coordinates   2866274..2867053 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus thuringiensis strain FDAARGOS_792     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2831950..2905876 2866274..2867053 within 0


Gene organization within MGE regions


Location: 2831950..2905876
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FOC86_RS15010 (FOC86_15000) - 2832293..2833963 (-) 1671 WP_000823087.1 ribonuclease J -
  FOC86_RS15015 (FOC86_15005) dapA 2834730..2835608 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  FOC86_RS15020 (FOC86_15010) dapG 2835620..2836852 (-) 1233 WP_000692470.1 aspartate kinase -
  FOC86_RS15025 (FOC86_15015) asd 2836876..2837922 (-) 1047 WP_000414842.1 aspartate-semialdehyde dehydrogenase -
  FOC86_RS15030 (FOC86_15020) dpaB 2838073..2838672 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  FOC86_RS15035 (FOC86_15025) dpaA 2838669..2839571 (-) 903 WP_000954724.1 dipicolinic acid synthetase subunit A -
  FOC86_RS15040 (FOC86_15030) - 2839846..2840097 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  FOC86_RS15045 (FOC86_15035) - 2840224..2841465 (-) 1242 WP_000592994.1 pitrilysin family protein -
  FOC86_RS15050 (FOC86_15040) - 2841552..2842451 (-) 900 WP_000647537.1 polysaccharide deacetylase family protein -
  FOC86_RS15055 (FOC86_15045) pnp 2842603..2844741 (-) 2139 WP_000076750.1 polyribonucleotide nucleotidyltransferase -
  FOC86_RS15060 (FOC86_15050) rpsO 2844902..2845171 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  FOC86_RS15065 (FOC86_15055) ribF 2845272..2846243 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  FOC86_RS15070 (FOC86_15060) truB 2846287..2847210 (-) 924 WP_000399346.1 tRNA pseudouridine(55) synthase TruB -
  FOC86_RS15075 (FOC86_15065) rbfA 2847297..2847653 (-) 357 WP_000776442.1 30S ribosome-binding factor RbfA -
  FOC86_RS15080 (FOC86_15070) - 2847669..2847950 (-) 282 WP_000582364.1 DUF503 domain-containing protein -
  FOC86_RS15085 (FOC86_15075) infB 2847947..2850007 (-) 2061 WP_000036341.1 translation initiation factor IF-2 -
  FOC86_RS15090 (FOC86_15080) - 2850012..2850323 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  FOC86_RS15095 (FOC86_15085) - 2850324..2850596 (-) 273 WP_000071128.1 YlxR family protein -
  FOC86_RS15100 (FOC86_15090) nusA 2850608..2851714 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  FOC86_RS15105 (FOC86_15095) rimP 2851732..2852202 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  FOC86_RS15110 (FOC86_15100) - 2852535..2856836 (-) 4302 WP_000059989.1 PolC-type DNA polymerase III -
  FOC86_RS15115 (FOC86_15105) - 2856961..2858661 (-) 1701 WP_000814310.1 proline--tRNA ligase -
  FOC86_RS15120 (FOC86_15110) rseP 2858771..2860027 (-) 1257 WP_001090229.1 RIP metalloprotease RseP -
  FOC86_RS15125 (FOC86_15115) dxr 2860044..2861186 (-) 1143 WP_000790356.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  FOC86_RS15130 (FOC86_15120) cdsA 2861210..2862001 (-) 792 WP_000813583.1 phosphatidate cytidylyltransferase -
  FOC86_RS15135 (FOC86_15125) uppS 2862019..2862795 (-) 777 WP_000971301.1 isoprenyl transferase -
  FOC86_RS15140 (FOC86_15130) frr 2862881..2863438 (-) 558 WP_000531503.1 ribosome recycling factor -
  FOC86_RS15145 (FOC86_15135) pyrH 2863441..2864163 (-) 723 WP_000042663.1 UMP kinase -
  FOC86_RS15150 (FOC86_15140) tsf 2864230..2865117 (-) 888 WP_001018581.1 translation elongation factor Ts -
  FOC86_RS15155 (FOC86_15145) rpsB 2865221..2865922 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  FOC86_RS15160 (FOC86_15150) codY 2866274..2867053 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  FOC86_RS15165 (FOC86_15155) hslU 2867131..2868522 (-) 1392 WP_000550088.1 ATP-dependent protease ATPase subunit HslU -
  FOC86_RS15170 (FOC86_15160) hslV 2868545..2869087 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  FOC86_RS15175 (FOC86_15165) xerC 2869130..2870029 (-) 900 WP_001101227.1 tyrosine recombinase XerC -
  FOC86_RS15180 (FOC86_15170) trmFO 2870095..2871399 (-) 1305 WP_001991958.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  FOC86_RS15185 (FOC86_15175) topA 2871450..2873528 (-) 2079 WP_001286968.1 type I DNA topoisomerase -
  FOC86_RS15190 (FOC86_15180) dprA 2873673..2874542 (-) 870 WP_000818032.1 DNA-processing protein DprA -
  FOC86_RS15195 (FOC86_15185) sucD 2874630..2875532 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  FOC86_RS15200 (FOC86_15190) sucC 2875552..2876712 (-) 1161 WP_001020785.1 ADP-forming succinate--CoA ligase subunit beta -
  FOC86_RS15205 (FOC86_15195) rnhB 2876906..2877679 (-) 774 WP_001174721.1 ribonuclease HII -
  FOC86_RS15210 (FOC86_15200) ylqF 2877731..2878621 (-) 891 WP_000236706.1 ribosome biogenesis GTPase YlqF -
  FOC86_RS15215 (FOC86_15205) lepB 2878642..2879193 (-) 552 WP_000711857.1 signal peptidase I -
  FOC86_RS15220 (FOC86_15210) rplS 2879295..2879639 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  FOC86_RS15225 (FOC86_15215) trmD 2879786..2880520 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  FOC86_RS15230 (FOC86_15220) rimM 2880520..2881035 (-) 516 WP_000170268.1 ribosome maturation factor RimM -
  FOC86_RS15235 (FOC86_15225) - 2881156..2881383 (-) 228 WP_000737398.1 KH domain-containing protein -
  FOC86_RS15240 (FOC86_15230) rpsP 2881398..2881670 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  FOC86_RS15245 (FOC86_15235) ffh 2881771..2883120 (-) 1350 WP_000863461.1 signal recognition particle protein -
  FOC86_RS15250 (FOC86_15240) - 2883133..2883465 (-) 333 WP_000891062.1 putative DNA-binding protein -
  FOC86_RS15255 (FOC86_15245) ftsY 2883599..2884588 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  FOC86_RS15260 (FOC86_15250) smc 2884604..2888173 (-) 3570 WP_000478987.1 chromosome segregation protein SMC -
  FOC86_RS15265 (FOC86_15255) rncS 2888320..2889057 (-) 738 WP_001146873.1 ribonuclease III -
  FOC86_RS15270 (FOC86_15260) acpP 2889116..2889349 (-) 234 WP_000786062.1 acyl carrier protein -
  FOC86_RS15275 (FOC86_15265) fabG 2889419..2890159 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  FOC86_RS15280 (FOC86_15270) fabD 2890159..2891103 (-) 945 WP_000516948.1 ACP S-malonyltransferase -
  FOC86_RS15285 (FOC86_15275) plsX 2891118..2892110 (-) 993 WP_000684110.1 phosphate acyltransferase PlsX -
  FOC86_RS15290 (FOC86_15280) fapR 2892107..2892700 (-) 594 WP_000747352.1 transcription factor FapR -
  FOC86_RS15295 (FOC86_15285) recG 2892789..2894837 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  FOC86_RS15300 (FOC86_15290) - 2895127..2896803 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  FOC86_RS15305 (FOC86_15295) - 2896826..2897188 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  FOC86_RS15310 (FOC86_15300) rpmB 2897567..2897755 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  FOC86_RS15315 (FOC86_15305) spoVM 2897829..2897909 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  FOC86_RS15320 (FOC86_15310) - 2897976..2898656 (-) 681 WP_042515256.1 thiamine diphosphokinase -
  FOC86_RS15325 (FOC86_15315) rpe 2898755..2899399 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  FOC86_RS15330 (FOC86_15320) rsgA 2899402..2900283 (-) 882 WP_001113935.1 ribosome small subunit-dependent GTPase A -
  FOC86_RS15335 (FOC86_15325) prkC 2900552..2902525 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  FOC86_RS15340 (FOC86_15330) - 2902534..2903286 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  FOC86_RS15345 (FOC86_15335) rlmN 2903291..2904379 (-) 1089 WP_000450546.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  FOC86_RS15350 (FOC86_15340) rsmB 2904384..2905718 (-) 1335 WP_001249680.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=449203 FOC86_RS15160 WP_000421288.1 2866274..2867053(-) (codY) [Bacillus thuringiensis strain FDAARGOS_792]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=449203 FOC86_RS15160 WP_000421288.1 2866274..2867053(-) (codY) [Bacillus thuringiensis strain FDAARGOS_792]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAACGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459