Detailed information    

insolico Bioinformatically predicted

Overview

Name   amiF   Type   Regulator
Locus tag   GE021_RS09210 Genome accession   NZ_CP053792
Coordinates   1877565..1878497 (-) Length   310 a.a.
NCBI ID   WP_125074145.1    Uniprot ID   A0A3P5Y6I4
Organism   Streptococcus canis strain HL_77_1     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1850680..1928362 1877565..1878497 within 0


Gene organization within MGE regions


Location: 1850680..1928362
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GE021_RS09075 (GE021_009065) pflB 1851876..1854203 (+) 2328 WP_003045209.1 formate C-acetyltransferase -
  GE021_RS09080 (GE021_009070) - 1854326..1854766 (+) 441 WP_164406420.1 GNAT family N-acetyltransferase -
  GE021_RS09085 (GE021_009075) - 1855464..1856399 (-) 936 WP_164406541.1 serine hydrolase domain-containing protein -
  GE021_RS09090 (GE021_009080) - 1856396..1857148 (-) 753 WP_125074151.1 CppA N-terminal domain-containing protein -
  GE021_RS09095 (GE021_009085) - 1857400..1858299 (+) 900 WP_125074130.1 sulfite exporter TauE/SafE family protein -
  GE021_RS09100 (GE021_009090) gla 1858592..1859440 (-) 849 WP_003045219.1 aquaglyceroporin Gla -
  GE021_RS09105 (GE021_009095) - 1859567..1861849 (+) 2283 WP_164406418.1 Xaa-Pro dipeptidyl-peptidase -
  GE021_RS09110 (GE021_009100) - 1862066..1862467 (-) 402 WP_164406416.1 pyridoxamine 5'-phosphate oxidase family protein -
  GE021_RS09115 (GE021_009105) - 1862646..1862867 (-) 222 WP_003045225.1 helix-turn-helix domain-containing protein -
  GE021_RS09120 (GE021_009110) - 1863037..1863411 (+) 375 WP_003045226.1 helix-turn-helix domain-containing protein -
  GE021_RS09125 (GE021_009115) - 1863939..1864967 (-) 1029 WP_164406414.1 cell wall metabolism sensor histidine kinase WalK -
  GE021_RS09130 (GE021_009120) - 1864969..1865655 (-) 687 WP_164406412.1 response regulator transcription factor -
  GE021_RS09135 (GE021_009125) - 1865774..1866196 (-) 423 WP_172774149.1 hypothetical protein -
  GE021_RS09140 (GE021_009130) - 1866454..1866753 (+) 300 WP_125074136.1 YbaB/EbfC family nucleoid-associated protein -
  GE021_RS09145 (GE021_009135) - 1866800..1867534 (-) 735 WP_164406409.1 MerR family transcriptional regulator -
  GE021_RS09150 (GE021_009140) - 1867686..1868273 (-) 588 WP_164406407.1 3'-5' exonuclease -
  GE021_RS09155 (GE021_009145) - 1868321..1868851 (-) 531 WP_111717589.1 DUF536 domain-containing protein -
  GE021_RS09160 (GE021_009150) - 1868977..1870152 (+) 1176 WP_164406405.1 NAD(P)/FAD-dependent oxidoreductase -
  GE021_RS09165 (GE021_009155) - 1870646..1871221 (+) 576 WP_254388087.1 hypothetical protein -
  GE021_RS11355 - 1871422..1871634 (+) 213 WP_254388088.1 hypothetical protein -
  GE021_RS09175 (GE021_009165) - 1871689..1872117 (-) 429 WP_164406403.1 hypothetical protein -
  GE021_RS09180 (GE021_009170) rpsN 1872465..1872734 (+) 270 WP_003052772.1 30S ribosomal protein S14 -
  GE021_RS09185 (GE021_009175) tsaD 1873041..1874063 (-) 1023 WP_164406401.1 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD -
  GE021_RS09190 (GE021_009180) rimI 1874053..1874478 (-) 426 WP_164406390.1 ribosomal protein S18-alanine N-acetyltransferase -
  GE021_RS09195 (GE021_009185) tsaB 1874480..1875178 (-) 699 WP_164406388.1 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB -
  GE021_RS09200 (GE021_009190) - 1875463..1875693 (+) 231 WP_003045256.1 DNA-dependent RNA polymerase subunit epsilon -
  GE021_RS09205 (GE021_009195) rnjA 1875695..1877377 (+) 1683 WP_125074144.1 ribonuclease J1 -
  GE021_RS09210 (GE021_009200) amiF 1877565..1878497 (-) 933 WP_125074145.1 ABC transporter ATP-binding protein Regulator
  GE021_RS09215 (GE021_009205) oppD 1878494..1879543 (-) 1050 WP_125074146.1 ABC transporter ATP-binding protein Regulator
  GE021_RS09220 (GE021_009210) - 1879555..1880586 (-) 1032 WP_125074147.1 ABC transporter permease -
  GE021_RS09225 (GE021_009215) - 1880596..1881510 (-) 915 WP_125074153.1 ABC transporter permease -
  GE021_RS11470 - 1881748..1882191 (+) 444 Protein_1790 transposase -
  GE021_RS09230 (GE021_009220) - 1882494..1884149 (-) 1656 WP_125074148.1 peptide ABC transporter substrate-binding protein -
  GE021_RS09235 (GE021_009225) glnA 1884380..1885726 (-) 1347 WP_125074149.1 type I glutamate--ammonia ligase -
  GE021_RS09240 (GE021_009230) - 1885764..1886135 (-) 372 WP_003045272.1 MerR family transcriptional regulator -
  GE021_RS09245 (GE021_009235) - 1886211..1886732 (-) 522 WP_125074150.1 aromatic acid exporter family protein -
  GE021_RS09250 (GE021_009240) - 1887511..1888852 (+) 1342 Protein_1795 IS3 family transposase -
  GE021_RS09255 (GE021_009245) pgk 1888921..1890117 (-) 1197 WP_003045276.1 phosphoglycerate kinase -
  GE021_RS09260 (GE021_009250) - 1890438..1891295 (-) 858 WP_125074863.1 5'-nucleotidase, lipoprotein e(P4) family -
  GE021_RS09265 (GE021_009255) gap 1891478..1892488 (-) 1011 WP_125074862.1 type I glyceraldehyde-3-phosphate dehydrogenase -
  GE021_RS09270 (GE021_009260) fusA 1892829..1894907 (-) 2079 WP_093998891.1 elongation factor G -
  GE021_RS09275 (GE021_009265) rpsG 1895246..1895716 (-) 471 WP_125074861.1 30S ribosomal protein S7 -
  GE021_RS09280 (GE021_009270) rpsL 1895737..1896150 (-) 414 WP_002986049.1 30S ribosomal protein S12 -
  GE021_RS09285 (GE021_009275) - 1896361..1898982 (-) 2622 WP_125074860.1 SEC10/PgrA surface exclusion domain-containing protein -
  GE021_RS09290 (GE021_009280) purR 1899006..1899821 (-) 816 WP_003045333.1 pur operon repressor -
  GE021_RS09295 (GE021_009285) - 1899921..1900859 (-) 939 WP_125074864.1 3'-5' exoribonuclease YhaM family protein -
  GE021_RS09300 (GE021_009290) rmuC 1900849..1902120 (-) 1272 WP_125074859.1 DNA recombination protein RmuC -
  GE021_RS09305 (GE021_009295) - 1902122..1902754 (-) 633 WP_125074858.1 thiamine diphosphokinase -
  GE021_RS09310 (GE021_009300) rpe 1902747..1903409 (-) 663 WP_125074857.1 ribulose-phosphate 3-epimerase -
  GE021_RS09315 (GE021_009305) rsgA 1903419..1904291 (-) 873 WP_164407582.1 ribosome small subunit-dependent GTPase A -
  GE021_RS09320 (GE021_009310) - 1904785..1905942 (-) 1158 WP_172774156.1 IS110 family transposase -
  GE021_RS09325 (GE021_009315) - 1906217..1907716 (+) 1500 WP_125074826.1 MDR family MFS transporter -
  GE021_RS09330 (GE021_009320) - 1907719..1908435 (+) 717 WP_164406555.1 DUF4811 domain-containing protein -
  GE021_RS09335 (GE021_009325) - 1908506..1910062 (-) 1557 WP_125074824.1 YfcC family protein -
  GE021_RS09340 (GE021_009330) arcC 1910169..1911101 (-) 933 WP_125074823.1 carbamate kinase -
  GE021_RS09345 (GE021_009335) argF 1911113..1912111 (-) 999 WP_125074822.1 ornithine carbamoyltransferase -
  GE021_RS09350 (GE021_009340) - 1912216..1913511 (+) 1296 WP_125074821.1 ATP-binding protein -
  GE021_RS09355 (GE021_009345) - 1913508..1914356 (+) 849 WP_125074820.1 DNA-binding domain-containing protein -
  GE021_RS09360 (GE021_009350) rsmA 1914412..1915284 (-) 873 WP_125074827.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
  GE021_RS09365 (GE021_009355) - 1915425..1915667 (-) 243 WP_125074819.1 hypothetical protein -
  GE021_RS09370 (GE021_009360) rnmV 1915657..1916247 (-) 591 WP_172774150.1 ribonuclease M5 -
  GE021_RS09375 (GE021_009365) - 1916219..1917010 (-) 792 WP_164406560.1 TatD family hydrolase -
  GE021_RS09380 (GE021_009370) - 1917104..1917268 (-) 165 WP_164406562.1 hypothetical protein -
  GE021_RS09385 (GE021_009375) - 1917325..1917588 (-) 264 WP_125074816.1 hypothetical protein -
  GE021_RS09390 (GE021_009380) - 1917772..1918335 (+) 564 WP_125074815.1 isochorismatase family protein -
  GE021_RS09395 (GE021_009385) - 1918428..1919258 (+) 831 WP_164406565.1 MurR/RpiR family transcriptional regulator -
  GE021_RS09400 (GE021_009390) - 1919356..1920873 (-) 1518 WP_125074813.1 PTS transporter subunit EIIC -
  GE021_RS09405 (GE021_009395) - 1920879..1921586 (-) 708 WP_125074812.1 N-acetylmannosamine-6-phosphate 2-epimerase -
  GE021_RS09410 (GE021_009400) rpmH 1921911..1922045 (-) 135 WP_002885866.1 50S ribosomal protein L34 -
  GE021_RS09415 (GE021_009405) - 1922490..1923803 (-) 1314 WP_125074811.1 ISLre2 family transposase -
  GE021_RS09420 (GE021_009410) - 1923945..1924259 (-) 315 WP_003045380.1 hypothetical protein -
  GE021_RS09425 (GE021_009415) - 1924263..1924526 (-) 264 WP_164227773.1 hypothetical protein -
  GE021_RS09430 (GE021_009420) - 1924658..1925245 (-) 588 WP_003045384.1 hypothetical protein -
  GE021_RS09435 (GE021_009425) - 1925256..1926593 (-) 1338 WP_164227772.1 CHAP domain-containing protein -
  GE021_RS09440 (GE021_009430) - 1926603..1926851 (-) 249 WP_003045388.1 hypothetical protein -

Sequence

Protein


Download         Length: 310 a.a.        Molecular weight: 35177.07 Da        Isoelectric Point: 7.0422

>NTDB_id=447292 GE021_RS09210 WP_125074145.1 1877565..1878497(-) (amiF) [Streptococcus canis strain HL_77_1]
MNDNRKKLVALKNVSLTFNKGKKNEVKAIDNVSFDIYEGEVFGLVGESGSGKTTVGRAILKLYDISEGEIIFNGETVSHL
KGKDLRTFRKDAQMIFQDPQASLNGRMKIRDIVAEGLDIHGLTASKAEREERVQELLDLVGLNKDHLTRYPYEFSGGQRQ
RIGIARALAVKPKFIIADEPISALDVSIQAQVVNLMQKLQRKRGLTYLFIAHDLSMVKYISDRIGVMHWGKMLEIGTSDD
VYNHPIHPYTKSLLSAIPEPDPDKERQRVADVYDPSQELDGQERQMHEITPGHFVLATQEEADHYRRDYR

Nucleotide


Download         Length: 933 bp        

>NTDB_id=447292 GE021_RS09210 WP_125074145.1 1877565..1878497(-) (amiF) [Streptococcus canis strain HL_77_1]
ATGAATGACAATCGAAAAAAATTAGTAGCCTTAAAAAATGTCTCCCTAACCTTCAATAAGGGCAAGAAAAACGAAGTTAA
GGCTATTGATAACGTTAGTTTTGATATTTATGAAGGCGAAGTGTTTGGACTGGTGGGGGAATCAGGGTCAGGGAAAACAA
CAGTTGGCCGTGCGATTCTGAAACTTTATGATATTAGTGAGGGAGAAATCATTTTTAATGGTGAAACTGTTTCTCACCTG
AAAGGGAAAGACTTGCGGACCTTCCGTAAGGATGCCCAAATGATTTTCCAAGACCCTCAGGCCAGTCTCAATGGTCGTAT
GAAAATTAGAGATATTGTGGCAGAAGGGCTAGATATTCATGGCCTGACGGCTTCAAAAGCAGAGCGAGAAGAGCGGGTGC
AAGAACTCCTTGACTTAGTTGGATTGAATAAGGATCATTTAACCCGTTACCCGTATGAATTTTCAGGAGGGCAACGTCAG
CGGATTGGGATTGCCCGCGCTTTGGCGGTCAAACCTAAATTTATCATTGCTGATGAACCTATCTCAGCTCTCGATGTGTC
CATTCAGGCACAGGTGGTTAATTTGATGCAAAAACTTCAGCGCAAACGTGGCTTGACCTATCTCTTTATTGCTCATGACT
TGTCCATGGTTAAATATATTTCTGACCGTATTGGCGTCATGCATTGGGGCAAAATGTTGGAGATTGGGACATCAGATGAT
GTTTACAATCATCCCATTCACCCCTACACCAAGAGTCTGCTTTCGGCTATTCCTGAGCCAGATCCTGACAAAGAACGGCA
ACGTGTGGCTGATGTTTATGACCCTAGTCAAGAATTGGACGGTCAGGAGCGCCAAATGCACGAAATTACCCCAGGGCATT
TTGTTTTAGCTACCCAAGAAGAAGCTGACCATTATCGACGTGACTATCGTTAA

Domains

Predicted by InterproScan.

Oligopeptide/dipeptide transporter, C-terminal region (oligo_HPY)

(233-268)

ABC transporter (ABC_tran)

(30-181)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A3P5Y6I4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiF Streptococcus thermophilus LMD-9

53.443

98.387

0.526
  amiF Streptococcus thermophilus LMG 18311

53.115

98.387

0.523
  amiF Streptococcus salivarius strain HSISS4

52.787

98.387

0.519