Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   HPQ66_RS14435 Genome accession   NZ_CP053764
Coordinates   2992346..2992486 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain B268     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2987346..2997486
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPQ66_RS14410 (HPQ66_14460) - 2987686..2988069 (-) 384 WP_061047114.1 hotdog fold thioesterase -
  HPQ66_RS14415 (HPQ66_14465) comA 2988091..2988735 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  HPQ66_RS14420 (HPQ66_14470) comP 2988816..2991107 (-) 2292 WP_042635452.1 histidine kinase Regulator
  HPQ66_RS14425 (HPQ66_14475) comX 2991119..2991283 (-) 165 WP_007613432.1 competence pheromone ComX -
  HPQ66_RS14430 (HPQ66_14480) - 2991283..2992194 (-) 912 WP_079891433.1 polyprenyl synthetase family protein -
  HPQ66_RS14435 (HPQ66_14485) degQ 2992346..2992486 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  HPQ66_RS14440 (HPQ66_14490) - 2992949..2993290 (+) 342 WP_007408677.1 hypothetical protein -
  HPQ66_RS14445 (HPQ66_14495) - 2993297..2994520 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  HPQ66_RS14450 (HPQ66_14500) - 2994650..2996116 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  HPQ66_RS14455 (HPQ66_14505) - 2996134..2996685 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  HPQ66_RS14460 (HPQ66_14510) - 2996782..2997180 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=447010 HPQ66_RS14435 WP_003152043.1 2992346..2992486(-) (degQ) [Bacillus velezensis strain B268]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=447010 HPQ66_RS14435 WP_003152043.1 2992346..2992486(-) (degQ) [Bacillus velezensis strain B268]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891