Detailed information    

insolico Bioinformatically predicted

Overview

Name   codY   Type   Regulator
Locus tag   HPG46_RS18645 Genome accession   NZ_CP053656
Coordinates   3624096..3624875 (-) Length   259 a.a.
NCBI ID   WP_000421288.1    Uniprot ID   Q81WK7
Organism   Bacillus cereus strain CTMA_1571     
Function   repression of comK (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3589772..3663702 3624096..3624875 within 0


Gene organization within MGE regions


Location: 3589772..3663702
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPG46_RS18495 (HPG46_18095) - 3590115..3591785 (-) 1671 WP_000823085.1 ribonuclease J -
  HPG46_RS18500 (HPG46_18100) dapA 3592552..3593430 (-) 879 WP_000564761.1 4-hydroxy-tetrahydrodipicolinate synthase -
  HPG46_RS18505 (HPG46_18105) dapG 3593442..3594674 (-) 1233 WP_000692470.1 aspartate kinase -
  HPG46_RS18510 (HPG46_18110) asd 3594698..3595744 (-) 1047 WP_000414849.1 aspartate-semialdehyde dehydrogenase -
  HPG46_RS18515 (HPG46_18115) dpaB 3595895..3596494 (-) 600 WP_001049484.1 dipicolinate synthase subunit B -
  HPG46_RS18520 (HPG46_18120) dpaA 3596491..3597393 (-) 903 WP_000954726.1 dipicolinic acid synthetase subunit A -
  HPG46_RS18525 (HPG46_18125) - 3597668..3597919 (-) 252 WP_001239752.1 YlmC/YmxH family sporulation protein -
  HPG46_RS18530 (HPG46_18130) - 3598046..3599287 (-) 1242 WP_000592993.1 pitrilysin family protein -
  HPG46_RS18535 (HPG46_18135) - 3599374..3600273 (-) 900 WP_000647529.1 polysaccharide deacetylase family protein -
  HPG46_RS18540 (HPG46_18140) pnp 3600425..3602563 (-) 2139 WP_000076750.1 polyribonucleotide nucleotidyltransferase -
  HPG46_RS18545 (HPG46_18145) rpsO 3602724..3602993 (-) 270 WP_001229392.1 30S ribosomal protein S15 -
  HPG46_RS18550 (HPG46_18150) ribF 3603094..3604065 (-) 972 WP_000766711.1 bifunctional riboflavin kinase/FAD synthetase -
  HPG46_RS18555 (HPG46_18155) truB 3604109..3605032 (-) 924 WP_000399337.1 tRNA pseudouridine(55) synthase TruB -
  HPG46_RS18560 (HPG46_18160) rbfA 3605119..3605475 (-) 357 WP_000776441.1 30S ribosome-binding factor RbfA -
  HPG46_RS18565 (HPG46_18165) - 3605491..3605772 (-) 282 WP_000582364.1 DUF503 family protein -
  HPG46_RS18570 (HPG46_18170) infB 3605769..3607829 (-) 2061 WP_000036341.1 translation initiation factor IF-2 -
  HPG46_RS18575 (HPG46_18175) - 3607834..3608145 (-) 312 WP_001286523.1 YlxQ family RNA-binding protein -
  HPG46_RS18580 (HPG46_18180) - 3608146..3608418 (-) 273 WP_000071128.1 YlxR family protein -
  HPG46_RS18585 (HPG46_18185) nusA 3608430..3609536 (-) 1107 WP_000102609.1 transcription termination factor NusA -
  HPG46_RS18590 (HPG46_18190) rimP 3609554..3610024 (-) 471 WP_000359097.1 ribosome maturation factor RimP -
  HPG46_RS18595 (HPG46_18195) - 3610357..3614658 (-) 4302 WP_000059985.1 PolC-type DNA polymerase III -
  HPG46_RS18600 (HPG46_18200) proS 3614783..3616483 (-) 1701 WP_086421442.1 proline--tRNA ligase -
  HPG46_RS18605 (HPG46_18205) rseP 3616593..3617849 (-) 1257 WP_001090229.1 RIP metalloprotease RseP -
  HPG46_RS18610 (HPG46_18210) dxr 3617866..3619008 (-) 1143 WP_000790359.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  HPG46_RS18615 (HPG46_18215) cdsA 3619032..3619823 (-) 792 WP_000813583.1 phosphatidate cytidylyltransferase -
  HPG46_RS18620 (HPG46_18220) uppS 3619841..3620617 (-) 777 WP_000971301.1 isoprenyl transferase -
  HPG46_RS18625 (HPG46_18225) frr 3620703..3621260 (-) 558 WP_000531503.1 ribosome recycling factor -
  HPG46_RS18630 (HPG46_18230) pyrH 3621263..3621985 (-) 723 WP_000042663.1 UMP kinase -
  HPG46_RS18635 (HPG46_18235) tsf 3622052..3622939 (-) 888 WP_001018581.1 translation elongation factor Ts -
  HPG46_RS18640 (HPG46_18240) rpsB 3623043..3623744 (-) 702 WP_000111483.1 30S ribosomal protein S2 -
  HPG46_RS18645 (HPG46_18245) codY 3624096..3624875 (-) 780 WP_000421288.1 GTP-sensing pleiotropic transcriptional regulator CodY Regulator
  HPG46_RS18650 (HPG46_18250) hslU 3624953..3626344 (-) 1392 WP_171856316.1 ATP-dependent protease ATPase subunit HslU -
  HPG46_RS18655 (HPG46_18255) hslV 3626367..3626909 (-) 543 WP_000526272.1 ATP-dependent protease proteolytic subunit HslV -
  HPG46_RS18660 (HPG46_18260) xerC 3626952..3627851 (-) 900 WP_001101227.1 tyrosine recombinase XerC -
  HPG46_RS18665 (HPG46_18265) trmFO 3627917..3629221 (-) 1305 WP_003295032.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  HPG46_RS18670 (HPG46_18270) topA 3629272..3631350 (-) 2079 WP_001286969.1 type I DNA topoisomerase -
  HPG46_RS18675 (HPG46_18275) dprA 3631495..3632364 (-) 870 WP_000818033.1 DNA-processing protein DprA -
  HPG46_RS18680 (HPG46_18280) sucD 3632452..3633354 (-) 903 WP_000115178.1 succinate--CoA ligase subunit alpha -
  HPG46_RS18685 (HPG46_18285) sucC 3633374..3634534 (-) 1161 WP_001020785.1 ADP-forming succinate--CoA ligase subunit beta -
  HPG46_RS18690 (HPG46_18290) rnhB 3634728..3635501 (-) 774 WP_086421439.1 ribonuclease HII -
  HPG46_RS18695 (HPG46_18295) ylqF 3635553..3636443 (-) 891 WP_000236696.1 ribosome biogenesis GTPase YlqF -
  HPG46_RS18700 (HPG46_18300) lepB 3636464..3637015 (-) 552 WP_000711857.1 signal peptidase I -
  HPG46_RS18705 (HPG46_18305) rplS 3637117..3637461 (-) 345 WP_001186516.1 50S ribosomal protein L19 -
  HPG46_RS18710 (HPG46_18310) trmD 3637608..3638342 (-) 735 WP_000686892.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  HPG46_RS18715 (HPG46_18315) rimM 3638342..3638857 (-) 516 WP_000170268.1 ribosome maturation factor RimM -
  HPG46_RS18720 (HPG46_18320) - 3638978..3639205 (-) 228 WP_000737398.1 KH domain-containing protein -
  HPG46_RS18725 (HPG46_18325) rpsP 3639220..3639492 (-) 273 WP_000268750.1 30S ribosomal protein S16 -
  HPG46_RS18730 (HPG46_18330) ffh 3639593..3640942 (-) 1350 WP_000863461.1 signal recognition particle protein -
  HPG46_RS18735 (HPG46_18335) - 3640955..3641287 (-) 333 WP_000891062.1 putative DNA-binding protein -
  HPG46_RS18740 (HPG46_18340) ftsY 3641421..3642410 (-) 990 WP_000007650.1 signal recognition particle-docking protein FtsY -
  HPG46_RS18745 (HPG46_18345) smc 3642426..3645995 (-) 3570 WP_171856317.1 chromosome segregation protein SMC -
  HPG46_RS18750 (HPG46_18350) rncS 3646142..3646879 (-) 738 WP_001146873.1 ribonuclease III -
  HPG46_RS18755 (HPG46_18355) acpP 3646938..3647171 (-) 234 WP_000786062.1 acyl carrier protein -
  HPG46_RS18760 (HPG46_18360) fabG 3647241..3647981 (-) 741 WP_000911782.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  HPG46_RS18765 (HPG46_18365) fabD 3647981..3648925 (-) 945 WP_000516948.1 ACP S-malonyltransferase -
  HPG46_RS18770 (HPG46_18370) plsX 3648940..3649932 (-) 993 WP_000684108.1 phosphate acyltransferase PlsX -
  HPG46_RS18775 (HPG46_18375) fapR 3649929..3650522 (-) 594 WP_000747352.1 transcription factor FapR -
  HPG46_RS18780 (HPG46_18380) recG 3650611..3652659 (-) 2049 WP_001006884.1 ATP-dependent DNA helicase RecG -
  HPG46_RS18785 (HPG46_18385) - 3652949..3654625 (-) 1677 WP_000027136.1 DAK2 domain-containing protein -
  HPG46_RS18790 (HPG46_18390) - 3654648..3655010 (-) 363 WP_000021109.1 Asp23/Gls24 family envelope stress response protein -
  HPG46_RS18795 (HPG46_18395) rpmB 3655389..3655577 (+) 189 WP_000124776.1 50S ribosomal protein L28 -
  HPG46_RS18800 (HPG46_18400) spoVM 3655651..3655731 (-) 81 WP_001213599.1 stage V sporulation protein SpoVM -
  HPG46_RS18805 (HPG46_18405) - 3655798..3656478 (-) 681 WP_025388434.1 thiamine diphosphokinase -
  HPG46_RS18810 (HPG46_18410) rpe 3656578..3657222 (-) 645 WP_000589966.1 ribulose-phosphate 3-epimerase -
  HPG46_RS18815 (HPG46_18415) rsgA 3657225..3658106 (-) 882 WP_171856318.1 ribosome small subunit-dependent GTPase A -
  HPG46_RS18820 (HPG46_18420) prkC 3658378..3660351 (-) 1974 WP_000904759.1 serine/threonine protein kinase PrkC -
  HPG46_RS18825 (HPG46_18425) - 3660360..3661112 (-) 753 WP_000648699.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  HPG46_RS18830 (HPG46_18430) rlmN 3661117..3662205 (-) 1089 WP_000450543.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  HPG46_RS18835 (HPG46_18435) rsmB 3662210..3663544 (-) 1335 WP_171856319.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -

Sequence

Protein


Download         Length: 259 a.a.        Molecular weight: 28774.05 Da        Isoelectric Point: 4.7947

>NTDB_id=446014 HPG46_RS18645 WP_000421288.1 3624096..3624875(-) (codY) [Bacillus cereus strain CTMA_1571]
MELLAKTRKLNALLQSAAGKPVNFREMSDTMCEVIEANVFVVSRRGKLLGYAIHQQIENERMKQMLAERQFPEEYTQSLF
NITETSSNLDVNSAYTAFPVENKELFGQGLTTIVPIVGGGERLGTLVLARLGQEFLDDDLILAEYSSTVVGMEILREKAE
EIEEEARSKAVVQMAISSLSYSELEAIEHIFEELNGTEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGT
YIKVLNDKFLHELAKLKTN

Nucleotide


Download         Length: 780 bp        

>NTDB_id=446014 HPG46_RS18645 WP_000421288.1 3624096..3624875(-) (codY) [Bacillus cereus strain CTMA_1571]
ATGGAATTATTAGCAAAAACAAGAAAATTAAATGCGTTATTACAGAGCGCAGCAGGAAAGCCTGTAAACTTTAGAGAAAT
GTCTGACACAATGTGTGAAGTAATCGAAGCGAACGTATTCGTAGTAAGTCGTCGTGGTAAATTACTAGGTTATGCAATTC
ACCAACAAATCGAGAATGAGCGTATGAAACAAATGCTTGCAGAACGTCAATTCCCAGAAGAGTATACACAAAGCTTATTC
AACATTACAGAAACATCTTCAAACTTAGATGTAAACAGTGCTTACACAGCATTCCCAGTAGAAAATAAAGAATTATTTGG
TCAAGGTTTAACTACAATCGTACCGATCGTTGGTGGCGGTGAGCGTCTAGGTACATTAGTTTTAGCTCGTCTTGGTCAAG
AGTTCTTAGATGATGATTTAATTCTTGCTGAGTACAGCTCAACTGTTGTAGGTATGGAAATTTTACGTGAAAAAGCAGAA
GAAATCGAAGAAGAAGCACGTAGCAAAGCTGTTGTTCAAATGGCGATCAGCTCATTATCTTACAGTGAATTAGAAGCAAT
CGAGCACATCTTCGAAGAATTAAACGGAACAGAAGGTTTACTTGTTGCAAGTAAAATTGCTGACCGCGTAGGAATCACTC
GTTCGGTAATCGTAAATGCACTTCGTAAATTAGAAAGTGCTGGTGTAATTGAGTCGCGTTCTTTAGGTATGAAAGGAACA
TACATTAAAGTATTAAATGACAAATTCTTACATGAACTTGCTAAATTAAAAACAAACTAA

Domains

Predicted by InterproScan.

CodY GAF-like domain (CodY)

(2-178)

CodY helix-turn-helix domain (HTH_CodY)

(198-255)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q81WK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  codY Bacillus subtilis subsp. subtilis str. 168

81.081

100

0.811
  codY Lactococcus lactis subsp. lactis strain DGCC12653

46.667

98.456

0.459