Detailed information    

insolico Bioinformatically predicted

Overview

Name   comS   Type   Regulator
Locus tag   HG697_RS10410 Genome accession   NZ_CP051623
Coordinates   57656..57754 (+) Length   32 a.a.
NCBI ID   WP_014611913.1    Uniprot ID   A0A380JYX6
Organism   Streptococcus dysgalactiae subsp. equisimilis strain TPCH-A19     
Function   activate transcription of comX (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 45011..61554 57656..57754 within 0


Gene organization within MGE regions


Location: 45011..61554
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG697_RS00300 (HG697_00300) purM 45011..46039 (+) 1029 WP_003062570.1 phosphoribosylformylglycinamidine cyclo-ligase -
  HG697_RS00305 (HG697_00305) purN 46032..46586 (+) 555 WP_003056410.1 phosphoribosylglycinamide formyltransferase -
  HG697_RS00310 (HG697_00310) - 46693..47205 (+) 513 WP_015057184.1 VanZ family protein -
  HG697_RS00315 (HG697_00315) purH 47224..48768 (+) 1545 WP_015057185.1 bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase -
  HG697_RS00320 (HG697_00320) - 48848..49975 (-) 1128 WP_003055557.1 SH3 domain-containing protein -
  HG697_RS00325 (HG697_00325) purD 50258..51520 (+) 1263 WP_015057186.1 phosphoribosylamine--glycine ligase -
  HG697_RS00330 (HG697_00330) purE 52158..52646 (+) 489 WP_015057187.1 5-(carboxyamino)imidazole ribonucleotide mutase -
  HG697_RS00335 (HG697_00335) purK 52633..53706 (+) 1074 WP_012766418.1 5-(carboxyamino)imidazole ribonucleotide synthase -
  HG697_RS00340 (HG697_00340) - 53716..54972 (+) 1257 WP_015057188.1 DUF4041 domain-containing protein -
  HG697_RS00345 (HG697_00345) - 54965..55174 (+) 210 WP_014611912.1 hypothetical protein -
  HG697_RS00350 (HG697_00350) purB 55223..56515 (+) 1293 WP_003056595.1 adenylosuccinate lyase -
  HG697_RS00355 (HG697_00355) comR 56658..57569 (+) 912 WP_003060893.1 XRE family transcriptional regulator Regulator
  HG697_RS10410 comS 57656..57754 (+) 99 WP_014611913.1 quorum-sensing system DWW-type pheromone Regulator
  HG697_RS00360 (HG697_00360) ruvB 57788..58786 (+) 999 WP_003059357.1 Holliday junction branch migration DNA helicase RuvB -
  HG697_RS00365 (HG697_00365) - 58921..59352 (+) 432 WP_003059365.1 low molecular weight protein-tyrosine-phosphatase -
  HG697_RS00370 (HG697_00370) - 59381..59782 (+) 402 WP_003049089.1 MORN repeat-containing protein -
  HG697_RS00375 (HG697_00375) - 59779..61554 (+) 1776 WP_003059359.1 acyltransferase family protein -

Sequence

Protein


Download         Length: 32 a.a.        Molecular weight: 3771.59 Da        Isoelectric Point: 10.4764

>NTDB_id=439864 HG697_RS10410 WP_014611913.1 57656..57754(+) (comS) [Streptococcus dysgalactiae subsp. equisimilis strain TPCH-A19]
MFKKIKPYLLLAAVVAFKVARAMNEFDWWNLG

Nucleotide


Download         Length: 99 bp        

>NTDB_id=439864 HG697_RS10410 WP_014611913.1 57656..57754(+) (comS) [Streptococcus dysgalactiae subsp. equisimilis strain TPCH-A19]
ATGTTTAAAAAAATCAAACCATATTTGTTATTAGCCGCAGTCGTTGCTTTCAAAGTTGCTCGTGCAATGAACGAATTTGA
TTGGTGGAACCTAGGGTGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A380JYX6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comS Streptococcus pyogenes MGAS315

84.375

100

0.844
  comS Streptococcus pyogenes MGAS8232

45.161

96.875

0.437